Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Growth arrest and DNA damage-inducible protein GADD45 gamma Recombinant Protein | GADD45G recombinant protein

Recombinant Human Growth arrest and DNA damage-inducible protein GADD45 gamma

Gene Names
GADD45G; CR6; DDIT2; GRP17; GADD45gamma
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Growth arrest and DNA damage-inducible protein GADD45 gamma; Recombinant Human Growth arrest and DNA damage-inducible protein GADD45 gamma; Cytokine-responsive protein CR6DNA damage-inducible transcript 2 protein; DDIT-2; GADD45G recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-159aa; Full Length
Sequence
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Sequence Length
159
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for GADD45G recombinant protein
Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.
Product Categories/Family for GADD45G recombinant protein
References
A family of stress-inducible GADD45-like proteins mediate activation of the stress-responsive MTK1/MEKK4 MAPKKK.Takekawa M., Saito H.Cell 95:521-530(1998)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33.1 kDa
NCBI Official Full Name
growth arrest and DNA damage-inducible protein GADD45 gamma
NCBI Official Synonym Full Names
growth arrest and DNA damage inducible gamma
NCBI Official Symbol
GADD45G
NCBI Official Synonym Symbols
CR6; DDIT2; GRP17; GADD45gamma
NCBI Protein Information
growth arrest and DNA damage-inducible protein GADD45 gamma
UniProt Protein Name
Growth arrest and DNA damage-inducible protein GADD45 gamma
UniProt Gene Name
GADD45G
UniProt Synonym Gene Names
CR6; DDIT2; DDIT-2
UniProt Entry Name
GA45G_HUMAN

NCBI Description

This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. [provided by RefSeq, Jul 2008]

Uniprot Description

GADD45G: Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK. Belongs to the GADD45 family.

Protein type: Apoptosis; DNA repair, damage; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 9q22.1-q22.2

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding

Biological Process: activation of MAPKK activity; activation of MAPKKK activity; apoptosis; cell differentiation; multicellular organismal development; negative regulation of protein kinase activity; positive regulation of apoptosis; positive regulation of JNK cascade; regulation of cell cycle; response to stress

Research Articles on GADD45G

Similar Products

Product Notes

The GADD45G gadd45g (Catalog #AAA1198623) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-159aa; Full Length. The amino acid sequence is listed below: MTLEEVRGQD TVPESTARMQ GAGKALHELL LSAQRQGCLT AGVYESAKVL NVDPDNVTFC VLAAGEEDEG DIALQIHFTL IQAFCCENDI DIVRVGDVQR LAAIVGAGEE AGAPGDLHCI LISNPNEDAW KDPALEKLSL FCEESRSVND WVPSITLPE. It is sometimes possible for the material contained within the vial of "Growth arrest and DNA damage-inducible protein GADD45 gamma, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.