Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Rasl10aAntibody Dilution: 1.0ug/mlSample Type: Mouse Lung)

Rabbit Rasl10a Polyclonal Antibody | anti-RASL10A antibody

Rasl10a antibody - N-terminal region

Gene Names
Rasl10a; AI852688; 2210403B10Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Rasl10a; Polyclonal Antibody; Rasl10a antibody - N-terminal region; anti-RASL10A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TAIIRQFLFGDYPERHRPTDSPCLYRPAVLLDGAVYDLSIRDGDVAGPGS
Sequence Length
203
Applicable Applications for anti-RASL10A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Rasl10aAntibody Dilution: 1.0ug/mlSample Type: Mouse Lung)

Western Blot (WB) (Host: RabbitTarget Name: Rasl10aAntibody Dilution: 1.0ug/mlSample Type: Mouse Lung)
Related Product Information for anti-RASL10A antibody
This is a rabbit polyclonal antibody against Rasl10a. It was validated on Western Blot

Target Description: Rasl10a is a potent inhibitor of cellular proliferation.
Product Categories/Family for anti-RASL10A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
ras-like protein family member 10A isoform 1
NCBI Official Synonym Full Names
RAS-like, family 10, member A
NCBI Official Symbol
Rasl10a
NCBI Official Synonym Symbols
AI852688; 2210403B10Rik
NCBI Protein Information
ras-like protein family member 10A
UniProt Protein Name
Ras-like protein family member 10A
Protein Family
UniProt Gene Name
Rasl10a
UniProt Synonym Gene Names
Rrp22
UniProt Entry Name
RSLAA_MOUSE

Similar Products

Product Notes

The RASL10A rasl10a (Catalog #AAA3210656) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Rasl10a antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Rasl10a can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RASL10A rasl10a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAIIRQFLFG DYPERHRPTD SPCLYRPAVL LDGAVYDLSI RDGDVAGPGS. It is sometimes possible for the material contained within the vial of "Rasl10a, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.