Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CNOT8Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit CNOT8 Polyclonal Antibody | anti-CNOT8 antibody

CNOT8 Antibody - C-terminal region

Gene Names
CNOT8; CAF1; POP2; CALIF; Caf1b; hCAF1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity purified
Synonyms
CNOT8; Polyclonal Antibody; CNOT8 Antibody - C-terminal region; anti-CNOT8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQR
Sequence Length
292
Applicable Applications for anti-CNOT8 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CNOT8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CNOT8Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CNOT8Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CNOT8 antibody
This is a rabbit polyclonal antibody against CNOT8. It was validated on Western Blot

Target Description: CNOT8 has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Its function seems to be partially redundant with that of CNOT7. Catalytic component of the CCR4-NOT complex which is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. It associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity.
Product Categories/Family for anti-CNOT8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
CCR4-NOT transcription complex subunit 8 isoform 1
NCBI Official Synonym Full Names
CCR4-NOT transcription complex subunit 8
NCBI Official Symbol
CNOT8
NCBI Official Synonym Symbols
CAF1; POP2; CALIF; Caf1b; hCAF1
NCBI Protein Information
CCR4-NOT transcription complex subunit 8
UniProt Protein Name
CCR4-NOT transcription complex subunit 8
UniProt Gene Name
CNOT8
UniProt Synonym Gene Names
CALIF; POP2; CALIFp
UniProt Entry Name
CNOT8_HUMAN

Uniprot Description

CNOT8: Ubiquitous transcription factor required for a diverse set of processes. The CCR4-NOT complex functions as general transcription regulation complex. Belongs to the CAF1 family.

Protein type: EC 3.1.13.4

Chromosomal Location of Human Ortholog: 5q31-q33

Cellular Component: intracellular; cytosol; nucleus; CCR4-NOT complex

Molecular Function: protein binding; 3'-5'-exoribonuclease activity; poly(A)-specific ribonuclease activity; RNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of translation; negative regulation of cell proliferation; poly(A) tail shortening; regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of cell proliferation; gene expression; miRNA-mediated gene silencing; mRNA catabolic process, deadenylation-dependent decay

Research Articles on CNOT8

Similar Products

Product Notes

The CNOT8 cnot8 (Catalog #AAA3202730) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNOT8 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CNOT8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CNOT8 cnot8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DSRLPEEEHE FFHILNLFFP SIYDVKYLMK SCKNLKGGLQ EVADQLDLQR. It is sometimes possible for the material contained within the vial of "CNOT8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.