CCL5 active protein

Human CCL5, biotinylated

Cat. Num. AAA191492

• Gene Names: CCL5; SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta
• Purity: >97% by SDS-PAGE
• Synonyms: CCL5; Human CCL5; biotinylated; CCL5 active protein

• Purity/Purification: >97% by SDS-PAGE
• Form/Format: Lyophilized
• Sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQV CANPEKKWVREYINSLEMS
• Sequence Length: 154

• Endotoxin: <0.01 EU per 1ug of protein by LAL method
• Activity: EC50 = 0.25-0.50nM determined by Migration Assay in cells expressing recombinant CCR5.
• Modification: Biotinylated
• Reconstitution: Centrifuge tube prior to resuspending. Recommended at 100ug/ml in sterile distilled water.
• Carrier Protein: None
• Preparation and Storage: 12 months from date of receipt,-20 degree C to-70 degree C, as supplied.; 1 month,-20 degree C to-70 degree C, under sterile conditions after reconstitution.; Best if used immediately after reconstitution.; Avoid multiple freeze-thaw cycles.

Related Product Information for CCL5 active protein

Description: Recombinant human CCL5, produced in E Coli, corresponds to aa 24-91 (accession no. P13501).
Backgound: CCL5, also known as Regulated on Activation, Normal T-cell Expressed and Secreted (RANTES), is a proinflammatory chemokine that induces migration and activation of leukocytes, and is also implied in HIV infection. CCL5 binds to cell surface receptors CCR1, CCR3, CCR4, and CCR5. Its biological effects on leukocyte activation and HIV infections is dependent upon concentration and on the binding of cell surface glycosaminoglycans.

NCBI and Uniprot Product Information

• NCBI GI #: 524563423
• NCBI GeneID: 6352
• NCBI Accession #: NP_001265665.1
• NCBI GenBank Nucleotide #: NM_001278736.1
• Molecular Weight: 9,990 Da
• NCBI Official Full Name: C-C motif chemokine 5 isoform 2
• NCBI Official Synonym Full Names: C-C motif chemokine ligand 5
• NCBI Official Symbol: CCL5
• NCBI Official Synonym Symbols: SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta
• NCBI Protein Information: C-C motif chemokine 5
• UniProt Protein Name: C-C motif chemokine 5
• Protein Family: C-C motif chemokine
• UniProt Gene Name: CCL5
• UniProt Synonym Gene Names: D17S136E; SCYA5; TCP228

NCBI Description

This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]

Uniprot Description

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils (PubMed:16791620, PubMed:1380064, PubMed:8525373, PubMed:9516414, PubMed:15923218). May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells (PubMed:23979485).