Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

C-C motif chemokine 5 Recombinant Protein | CCL5 recombinant protein

Recombinant Human C-C motif chemokine 5

Gene Names
CCL5; SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C motif chemokine 5; Recombinant Human C-C motif chemokine 5; EoCP; Eosinophil chemotactic cytokine; SIS-delta; Small-inducible cytokine A5T cell-specific protein P228; TCP228T-cell-specific protein RANTES; CCL5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
24-91aa; Full Length
Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Sequence Length
91
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for CCL5 recombinant protein
Choattractant for blood monocytes, mory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells
Product Categories/Family for CCL5 recombinant protein
References
A human T cell-specific molecule is a member of a new gene family.Schall T.J., Jongstra J., Dyer B.J., Jorgensen J., Clayberger C., Davis M.M., Krensky A.M.J. Immunol. 141:1018-1025(1988) Organization of the chemokine gene cluster on human chromosome 17q11.2 containing the genes for CC chemokine MPIF-1, HCC-2, LEC, and RANTES.Nomiyama H., Fukuda S., Iio M., Tanase S., Miura R., Yoshie O.J. Interferon Cytokine Res. 19:227-234(1999) A natural CCL5/RANTES variant antagonist for CCR1 and CCR3.Capoulade-Metay C., Ayouba A., Kfutwah A., Lole K., Petres S., Dudoit Y., Deterre P., Menu E., Barre-Sinoussi F., Debre P., Theodorou I.Immunogenetics 58:533-541(2006) Jang J.S., Kim B.E. The complete sequence of human beta-chemokine RANTES mRNA.Zeng Q.P., Yang R.Y., Fu L.C.NIEHS SNPs program Cytokine RANTES released by thrombin-stimulated platelets is a potent attractant for human eosinophils.Kameyoshi Y., Doerschner A., Mallet A.I., Christophers E., Schroeder J.-M.J. Exp. Med. 176:587-592(1992) Platelets secrete an eosinophil-chemotactic cytokine which is a member of the C-C-chemokine family.Schroeder J.-M., Kameyoshi Y., Christophers E.Adv. Exp. Med. Biol. 351:119-128(1993) Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells.Cocchi F., DeVico A.L., Garzino-Demo A., Arya S.K., Gallo R.C., Lusso P.Science 270:1811-1815(1995) Amino-terminal truncation of chemokines by CD26/dipeptidyl-peptidase IV. Conversion of RANTES into a potent inhibitor of monocyte chemotaxis and HIV-1-infection.Proost P., De Meester I., Schols D., Struyf S., Lambeir A.-M., Wuyts A., Opdenakker G., De Clercq E., Scharpe S., Van Damme J.J. Biol. Chem. 273:7222-7227(1998) Multiple pathways of amino terminal processing produce two truncated variants of RANTES/CCL5.Lim J.K., Burns J.M., Lu W., DeVico A.L.J. Leukoc. Biol. 78:442-452(2005) RANTES stimulates Ca2+ mobilization and inositol trisphosphate (IP3) formation in cells transfected with G protein-coupled receptor 75.Ignatov A., Robert J., Gregory-Evans C., Schaller H.C.Br. J. Pharmacol. 149:490-497(2006) The novel chemokine receptor, G-protein-coupled receptor 75, is expressed by islets and is coupled to stimulation of insulin secretion and improved glucose homeostasis.Liu B., Hassan Z., Amisten S., King A.J., Bowe J.E., Huang G.C., Jones P.M., Persaud S.J.Diabetologia 56:2467-2476(2013) Proton NMR assignments and solution conformation of RANTES, a chemokine of the C-C type.Skelton N.J., Aspiras F., Ogez J., Schall T.J.Biochemistry 34:5329-5342(1995) The three-dimensional solution structure of RANTES.Chung C.-W., Cooke R.M., Proudfoot A.E.I., Wells T.N.C.Biochemistry 34:9307-9314(1995) Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV protein AOP-RANTES.Wilken J., Hoover D., Thompson D.A., Barlow P.N., McSparron H., Picard L., Wlodawer A., Lubkowski J., Kent S.B.Chem. Biol. 6:43-51(1999) The crystal structure of Met-RANTES comparison with native RANTES and AOP-RANTES.Hoover D.M., Shaw J., Gryczynski Z., Proudfoot A.E.I., Wells T.N.C., Lubkowski J.Protein Pept. Lett. 7:73-82(2000)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.9 kDa
NCBI Official Full Name
C-C motif chemokine 5 isoform 1
NCBI Official Synonym Full Names
C-C motif chemokine ligand 5
NCBI Official Symbol
CCL5
NCBI Official Synonym Symbols
SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta
NCBI Protein Information
C-C motif chemokine 5
UniProt Protein Name
C-C motif chemokine 5
Protein Family
UniProt Gene Name
CCL5
UniProt Synonym Gene Names
D17S136E; SCYA5; TCP228
UniProt Entry Name
CCL5_HUMAN

NCBI Description

This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]

Uniprot Description

CCL5: Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T- cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. By mitogens. T-cell and macrophage specific. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Cell adhesion; Chemokine; Secreted; Motility/polarity/chemotaxis; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: cytoplasm; extracellular region; extracellular space

Molecular Function: CCR1 chemokine receptor binding; CCR4 chemokine receptor binding; CCR5 chemokine receptor binding; chemoattractant activity; chemokine activity; chemokine receptor antagonist activity; chemokine receptor binding; heparin binding; phosphoinositide phospholipase C activity; phospholipase activator activity; protein binding; protein homodimerization activity; protein kinase activity; protein self-association; receptor signaling protein tyrosine kinase activator activity

Biological Process: aging; calcium ion transport; cell-cell signaling; cellular calcium ion homeostasis; cellular protein complex assembly; chemotaxis; chronic inflammatory response; dendritic cell chemotaxis; dibenzo-p-dioxin metabolic process; eosinophil chemotaxis; exocytosis; G-protein coupled receptor protein signaling pathway; inflammatory response; leukocyte adhesion; lipopolysaccharide-mediated signaling pathway; lymphocyte chemotaxis; macrophage chemotaxis; MAPKKK cascade; monocyte chemotaxis; negative regulation of G-protein coupled receptor protein signaling pathway; negative regulation of viral genome replication; neutrophil activation; neutrophil chemotaxis; phospholipase D activation; positive chemotaxis; positive regulation of angiogenesis; positive regulation of calcium ion transport; positive regulation of cell adhesion; positive regulation of cell migration; positive regulation of cell-cell adhesion mediated by integrin; positive regulation of cellular biosynthetic process; positive regulation of epithelial cell proliferation; positive regulation of fever; positive regulation of GTPase activity; positive regulation of homotypic cell-cell adhesion; positive regulation of inflammatory response; positive regulation of innate immune response; positive regulation of JAK-STAT cascade; positive regulation of neuron differentiation; positive regulation of osteoclast differentiation; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of phosphorylation; positive regulation of smooth muscle cell migration; positive regulation of smooth muscle cell proliferation; positive regulation of T cell proliferation; positive regulation of translational initiation; positive regulation of tyrosine phosphorylation of STAT protein; positive regulation of viral genome replication; protein kinase B signaling cascade; protein tetramerization; regulation of chronic inflammatory response; regulation of insulin secretion; regulation of T cell activation; response to activity; response to drug; response to estrogen stimulus; response to glucocorticoid stimulus; response to insulin stimulus; response to salt stress; response to toxin; response to virus

Research Articles on CCL5

Similar Products

Product Notes

The CCL5 ccl5 (Catalog #AAA717362) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-91aa; Full Length. The amino acid sequence is listed below: SPYSSDTTPC CFAYIARPLP RAHIKEYFYT SGKCSNPAVV FVTRKNRQVC ANPEKKWVRE YINSLEMS. It is sometimes possible for the material contained within the vial of "C-C motif chemokine 5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.