Toll/interleukin-1 receptor domain-containing adapter protein (Tirap) Recombinant Protein | Tirap recombinant protein
Recombinant Mouse Toll/interleukin-1 receptor domain-containing adapter protein (Tirap)
Gene Names
Tirap; Mal; Wyatt; Tlr4ap; AA407980; C130027E04Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Toll/interleukin-1 receptor domain-containing adapter protein (Tirap); Recombinant Mouse Toll/interleukin-1 receptor domain-containing adapter protein (Tirap); Tirap recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-241, full length protein
Sequence
MASSSSVPASSTPSKKPRDKIADWFRQALLKKPKKMPISQESHLYDGSQTATQDGLSPSSCSSPPSHSSPESRSSPSSCSSGMSPTSPPTHVDSSSSSSGRWSKDYDVCVCHSEEDLEAAQELVSYLEGSQASLRCFLQLRDAAPGGAIVSELCQALSRSHCRALLITPGFLRDPWCKYQMLQALTEAPASEGCTIPLLSGLSRAAYPPELRFMYYVDGRGKDGGFYQVKEAVIHYLETLS
Sequence Length
241
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Tirap recombinant protein
The innate immune system recognizes microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns. Different TLRs recognize different pathogen-associated molecular patterns and all TLRs have a Toll-interleukin 1 receptor (TIR) domain, which is responsible for signal transduction. This protein is a TIR adaptor protein involved in the TLR4 signaling pathway of the immune system. It activates NF-kappa-B, MAPK1, MAPK3 and JNK, which then results in cytokine secretion and the inflammatory response. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,035 Da
NCBI Official Full Name
toll/interleukin-1 receptor domain-containing adapter protein
NCBI Official Synonym Full Names
toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
NCBI Official Symbol
Tirap
NCBI Official Synonym Symbols
Mal; Wyatt; Tlr4ap; AA407980; C130027E04Rik
NCBI Protein Information
toll/interleukin-1 receptor domain-containing adapter protein
UniProt Protein Name
Toll/interleukin-1 receptor domain-containing adapter protein
UniProt Gene Name
Tirap
UniProt Synonym Gene Names
Mal; TIR domain-containing adapter protein
Uniprot Description
Adapter involved in the TLR2 and TLR4 signaling pathways in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response (). Positively regulates the production of TNF-alpha and interleukin-6 ().
Research Articles on Tirap
Similar Products
Product Notes
The Tirap tirap (Catalog #AAA1466989) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-241, full length protein. The amino acid sequence is listed below: MASSSSVPAS STPSKKPRDK IADWFRQALL KKPKKMPISQ ESHLYDGSQT ATQDGLSPSS CSSPPSHSSP ESRSSPSSCS SGMSPTSPPT HVDSSSSSSG RWSKDYDVCV CHSEEDLEAA QELVSYLEGS QASLRCFLQL RDAAPGGAIV SELCQALSRS HCRALLITPG FLRDPWCKYQ MLQALTEAPA SEGCTIPLLS GLSRAAYPPE LRFMYYVDGR GKDGGFYQVK EAVIHYLETL S. It is sometimes possible for the material contained within the vial of "Toll/interleukin-1 receptor domain-containing adapter protein (Tirap), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
