Protein-tyrosine phosphatase mitochondrial 1 (Ptpmt1) Recombinant Protein | Ptpmt1 recombinant protein
Recombinant Mouse Protein-tyrosine phosphatase mitochondrial 1 (Ptpmt1)
Gene Names
Ptpmt1; PLIP; 1110001D10Rik; 2810004N20Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein-tyrosine phosphatase mitochondrial 1 (Ptpmt1); Recombinant Mouse Protein-tyrosine phosphatase mitochondrial 1 (Ptpmt1); Ptpmt1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
32-193, full length protein
Sequence
PAHRDWYHRIDHTVLLGALPLKNMTRRLVLDENVRGVITMNEEYETRFLCNTSKEWKKAGVEQLRLSTVDMTGVPTLANLHKGVQFALKYQALGQCVYVHCKAGRSRSATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEVLKEFHKEITARAAKN
Sequence Length
162
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,943 Da
NCBI Official Full Name
phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1
NCBI Official Synonym Full Names
protein tyrosine phosphatase, mitochondrial 1
NCBI Official Symbol
Ptpmt1
NCBI Official Synonym Symbols
PLIP; 1110001D10Rik; 2810004N20Rik
NCBI Protein Information
phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1
UniProt Protein Name
Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1
UniProt Gene Name
Ptpmt1
UniProt Synonym Gene Names
Plip
Uniprot Description
Lipid phosphatase which dephosphorylates phosphatidylglycerophosphate (PGP) to phosphatidylglycerol (PG). PGP is an essential intermediate in the biosynthetic pathway of cardiolipin, a mitochondrial-specific phospholipid regulating the membrane integrity and activities of the organelle. Has also been shown to display phosphatase activity toward phosphoprotein substrates, specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells ().
Research Articles on Ptpmt1
Similar Products
Product Notes
The Ptpmt1 ptpmt1 (Catalog #AAA1442567) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 32-193, full length protein. The amino acid sequence is listed below: PAHRDWYHRI DHTVLLGALP LKNMTRRLVL DENVRGVITM NEEYETRFLC NTSKEWKKAG VEQLRLSTVD MTGVPTLANL HKGVQFALKY QALGQCVYVH CKAGRSRSAT MVAAYLIQVH NWSPEEAIEA IAKIRSHISI RPSQLEVLKE FHKEITARAA KN. It is sometimes possible for the material contained within the vial of "Protein-tyrosine phosphatase mitochondrial 1 (Ptpmt1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
