Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 Recombinant Protein | PTPMT1 recombinant protein

Recombinant Human Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1

Cat. Num. AAA1365570

• Gene Names: PTPMT1; MOSP; PLIP; DUSP23; PNAS-129
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1; Recombinant Human Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1; PTEN-like phosphatase; Phosphoinositide lipid phosphatase; Protein-tyrosine phosphatase mitochondrial 1 (EC:3.1.3.16; EC:3.1.3.48); PTPMT1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 28-201aa; Full Length
• Sequence: KVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT
• Sequence Length: 151

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for PTPMT1 recombinant protein

Lipid phosphatase which dephosphorylates phosphatidylglycerophosphate (PGP) to phosphatidylglycerol (PG). PGP is an essential intermediate in the biosynthetic pathway of cardiolipin, a mitochondrial-specific phospholipid regulating the membrane integrity and activities of the organelle. Has also been shown to display phosphatase activity toward phosphoprotein substrates, specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells.

Product Categories/Family for PTPMT1 recombinant protein

Signal Transduction

References

Lin L., Ke R., Li H., Zhou G., Shen C., Yu R., Zhong G., Xiao W., Li M., Yang S.Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006) Human acute promyelocytic leukemia cell line NB4's apoptosis/differentiation related genes.Yu W.-Q., Sun B.-Z., Chai Y.-B., Zhu F., Liu X.-S., Li Z., Lu F., Yan W., Yang H., Zhao Z.-L. Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012)

NCBI and Uniprot Product Information

• NCBI GI #: 221218988
• NCBI GeneID: 114971
• NCBI Accession #: NP_001137456.1
• NCBI GenBank Nucleotide #: NM_001143984.1
• UniProt Accession #: Q8WUK0; Q7Z557; Q96CR2; Q9BXV8; E9PAT8
• Molecular Weight: 35.9 kDa
• NCBI Official Full Name: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 isoform 2
• NCBI Official Synonym Full Names: protein tyrosine phosphatase, mitochondrial 1
• NCBI Official Symbol: PTPMT1
• NCBI Official Synonym Symbols: MOSP; PLIP; DUSP23; PNAS-129
• NCBI Protein Information: phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1
• UniProt Protein Name: Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1
• Protein Family: Phosphatidylglycerophosphatase and protein-tyrosine phosphatase
• UniProt Gene Name: PTPMT1
• UniProt Synonym Gene Names: MOSP; PLIP
• UniProt Entry Name: PTPM1_HUMAN

Uniprot Description

PTPMT1: Lipid phosphatase which dephosphorylates phosphatidylglycerophosphate (PGP) to phosphatidylglycerol (PG). PGP is an essential intermediate in the biosynthetic pathway of cardiolipin, a mitochondrial-specific phospholipid regulating the membrane integrity and activities of the organelle. Has also been shown to display phosphatase activity toward phosphoprotein substrates, specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells. Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.3.27; Mitochondrial; Phosphatase, lipid; EC 3.1.3.16; Protein phosphatase, dual-specificity; EC 3.1.3.48

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: integral to mitochondrial inner membrane; mitochondrion; nucleus

Molecular Function: phosphatidylglycerophosphatase activity; phosphoinositide 5-phosphatase activity; protein binding; protein tyrosine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity

Biological Process: cardiolipin biosynthetic process; glycerophospholipid biosynthetic process; phosphatidylglycerol biosynthetic process; phospholipid metabolic process