Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ZFP57Sample Type: Lymph Node Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit ZFP57 Polyclonal Antibody | anti-ZFP57 antibody

ZFP57 Antibody - N-terminal region

Gene Names
ZFP57; TNDM1; ZNF698; C6orf40; bA145L22; bA145L22.2
Reactivity
Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZFP57; Polyclonal Antibody; ZFP57 Antibody - N-terminal region; anti-ZFP57 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EDVAVNFTQEEWDCLDASQRVLYQDVMSETFKNLTSVARIFLHKPELITK
Sequence Length
452
Applicable Applications for anti-ZFP57 antibody
Western Blot (WB)
Homology
Human: 100%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZFP57
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ZFP57Sample Type: Lymph Node Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ZFP57Sample Type: Lymph Node Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ZFP57 antibody
This is a rabbit polyclonal antibody against ZFP57. It was validated on Western Blot

Target Description: The protein encoded by this gene is a zinc finger protein containing a KRAB domain. Studies in mouse suggest that this protein may function as a transcriptional repressor. Mutations in this gene have been associated with transient neonatal diabetes mellitus type 1 (TNDM1).
Product Categories/Family for anti-ZFP57 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Synonym Full Names
ZFP57 zinc finger protein
NCBI Official Symbol
ZFP57
NCBI Official Synonym Symbols
TNDM1; ZNF698; C6orf40; bA145L22; bA145L22.2
NCBI Protein Information
zinc finger protein 57 homolog
UniProt Protein Name
Zinc finger protein 57 homolog
Protein Family
UniProt Gene Name
ZFP57
UniProt Synonym Gene Names
C6orf40; ZNF698; Zfp-57
UniProt Entry Name
ZFP57_HUMAN

NCBI Description

The protein encoded by this gene is a zinc finger protein containing a KRAB domain. Studies in mouse suggest that this protein may function as a transcriptional repressor. Mutations in this gene have been associated with transient neonatal diabetes mellitus type 1 (TNDM1).[provided by RefSeq, Sep 2009]

Uniprot Description

ZFP57: Transcription regulator required to maintain maternal and paternal gene imprinting, a process by which gene expression is restricted in a parent of origin-specific manner by epigenetic modification of genomic DNA and chromatin, including DNA methylation. Acts by controlling DNA methylation during the earliest multicellular stages of development at multiple imprinting control regions. Required for the establishment of maternal methylation imprints at SNRPN locus. Acts as a transcriptional repressor in Schwann cells. Defects in ZFP57 are the cause of transient neonatal diabetes mellitus type 1 (TNDM1). Neonatal diabetes is a form of diabetes mellitus defined by the onset of mild-to- severe hyperglycemia within the first months of life. In about half of the neonates, diabetes is transient and resolves at a median age of 3 months, whereas the rest have a permanent form of diabetes. The major cause of TNDM1 is aberrant expression of imprinted genes at chromosome 6q24, associated in 20% of cases with DNA hypomethylation at the transient neonatal diabetes differentially methylated region (DMR), which lies within the imprinted promoter of the PLAGL1 gene. Over 50% of individuals with transient neonatal diabetes and hypomethylation at 6q24 also show mosaic DNA hypomethylation at other imprinted loci throughout the genome and a range of additional clinical features. Belongs to the krueppel C2H2-type zinc-finger protein family. ZFP57 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 6p22.1

Cellular Component: nuclear heterochromatin

Molecular Function: DNA binding; metal ion binding

Biological Process: genetic imprinting; transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; DNA methylation during embryonic development; peripheral nervous system development

Disease: Diabetes Mellitus, Transient Neonatal, 1

Research Articles on ZFP57

Similar Products

Product Notes

The ZFP57 zfp57 (Catalog #AAA3201082) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZFP57 Antibody - N-terminal region reacts with Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ZFP57 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZFP57 zfp57 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EDVAVNFTQE EWDCLDASQR VLYQDVMSET FKNLTSVARI FLHKPELITK. It is sometimes possible for the material contained within the vial of "ZFP57, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.