Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Heterogeneous nuclear ribonucleoprotein A/B (Hnrnpab) Recombinant Protein | Hnrnpab recombinant protein

Recombinant Mouse Heterogeneous nuclear ribonucleoprotein A/B (Hnrnpab)

Gene Names
Hnrnpab; CBF-A; Cgbfa; Hnrpab; 3010025C11Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Heterogeneous nuclear ribonucleoprotein A/B (Hnrnpab); Recombinant Mouse Heterogeneous nuclear ribonucleoprotein A/B (Hnrnpab); Hnrnpab recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-285, full length protein
Sequence
MSDAAEEQPMETTGATENGHEAAPEGEAPVEPSAAAAAPAASAGSGGGTTTAPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGQGSTNYGKSQRRGGHQNNYKPY
Sequence Length
285
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Hnrnpab recombinant protein
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes. They are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. This protein, which binds to one of the components of the multiprotein editosome complex, has two repeats of quasi-RRM (RNA recognition motif) domains that bind to RNAs. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,831 Da
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein A/B isoform 2
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein A/B
NCBI Official Symbol
Hnrnpab
NCBI Official Synonym Symbols
CBF-A; Cgbfa; Hnrpab; 3010025C11Rik
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein A/B
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein A/B
UniProt Gene Name
Hnrnpab
UniProt Synonym Gene Names
Cbf-a; Cgbfa; Hnrpab; hnRNP A/B; CBF-A

NCBI Description

This gene encodes a protein with consensus RNA binding domains present in a number of other RNA binding proteins and a glycine-rich C-terminus. This gene overlaps in a tail-to-tail orientation the gene encoding alanine-glyoxylate aminotransferase 2-like 2. Some of the exons of this gene are interspersed with exons of alanine-glyoxylate aminotransferase 2-like 2. Two alternatively spliced transcript variants that encode distinct proteins have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Transcriptional repressor. Binds to CArG box motifs, single-stranded and double-stranded DNA, and RNA. It may be that repression by CBF-A is a result of competitive binding of CBF, a putative positive factor, and CBF-A to the same or overlapping motifs around the CArG boxes.

Research Articles on Hnrnpab

Similar Products

Product Notes

The Hnrnpab hnrnpab (Catalog #AAA1419264) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-285, full length protein. The amino acid sequence is listed below: MSDAAEEQPM ETTGATENGH EAAPEGEAPV EPSAAAAAPA ASAGSGGGTT TAPSGNQNGA EGDQINASKN EEDAGKMFVG GLSWDTSKKD LKDYFTKFGE VVDCTIKMDP NTGRSRGFGF ILFKDSSSVE KVLDQKEHRL DGRVIDPKKA MAMKKDPVKK IFVGGLNPEA TEEKIREYFG QFGEIEAIEL PIDPKLNKRR GFVFITFKEE DPVKKVLEKK FHTVSGSKCE IKVAQPKEVY QQQQYGSGGR GNRNRGNRGS GGGQGSTNYG KSQRRGGHQN NYKPY. It is sometimes possible for the material contained within the vial of "Heterogeneous nuclear ribonucleoprotein A/B (Hnrnpab), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.