Rabbit anti-Human HNRNPAB Polyclonal Antibody | anti-HNRNPAB antibody

HNRNPAB Antibody - C-terminal region

Cat. Num. AAA3219886

• Gene Names: HNRNPAB; ABBP1; HNRPAB
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: HNRNPAB; Polyclonal Antibody; HNRNPAB Antibody - C-terminal region; anti-HNRNPAB antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQ
• Sequence Length: 332

• Applicable Applications for anti-HNRNPAB antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HNRNPAB
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HNRNPABSample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-HNRNPAB antibody

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes. They are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene, which binds to one of the components of the multiprotein editosome complex, has two repeats of quasi-RRM (RNA recognition motif) domains that bind to RNAs. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Product Categories/Family for anti-HNRNPAB antibody

Polyclonal; RNA Binding Proteins; Cell Biology; Chromatin & Nuclear Signaling; Developmental Biology; E3 & Ubiquitin; DNA/RNA/Protein Interactions

NCBI and Uniprot Product Information

• NCBI GI #: 55956919
• NCBI GeneID: 3182
• NCBI Accession #: NP_112556
• NCBI GenBank Nucleotide #: NM_031266.2
• UniProt Accession #: Q99729
• Molecular Weight: 36 kDa
• NCBI Official Full Name: heterogeneous nuclear ribonucleoprotein A/B isoform a
• NCBI Official Synonym Full Names: heterogeneous nuclear ribonucleoprotein A/B
• NCBI Official Symbol: HNRNPAB
• NCBI Official Synonym Symbols: ABBP1; HNRPAB
• NCBI Protein Information: heterogeneous nuclear ribonucleoprotein A/B
• UniProt Protein Name: Heterogeneous nuclear ribonucleoprotein A/B
• Protein Family: Heterogeneous nuclear ribonucleoprotein
• UniProt Gene Name: HNRNPAB
• UniProt Synonym Gene Names: ABBP1; HNRPAB; hnRNP A/B; ABBP-1
• UniProt Entry Name: ROAA_HUMAN

NCBI Description

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes. They are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene, which binds to one of the components of the multiprotein editosome complex, has two repeats of quasi-RRM (RNA recognition motif) domains that bind to RNAs. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

hnRNP A/B: a single-stranded RNA binding protein with two RNA-recognition (RRM) domains. Has a high affinity for G- rich and U-rich regions of hnRNA. Also binds to APOB mRNA transcripts around the RNA editing site. Interacts with APOBEC1. Observed in a mRNP granule complex, at least composed of ACTB, ACTN4, DHX9, ERG, HNRNPA1, HNRNPA2B1, HNRNPAB, HNRNPD, HNRNPL, HNRNPR, HNRNPU, HSPA1, HSPA8, IGF2BP1, ILF2, ILF3, NCBP1, NCL, PABPC1, PABPC4, PABPN1, RPLP0, RPS3, RPS3A, RPS4X, RPS8, RPS9, SYNCRIP, TROVE2, YBX1 and untranslated mRNAs. A member of the RNA recognition motif (RRM) family. Four isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 5q35.3

Cellular Component: nucleoplasm; cytoplasm; nucleus; ribonucleoprotein complex

Molecular Function: mRNA binding; RNA binding; sequence-specific DNA binding; nucleotide binding; transcription factor activity

Biological Process: positive regulation of transcription, DNA-dependent; epithelial to mesenchymal transition; negative regulation of transcription from RNA polymerase II promoter