Programmed cell death protein 10 Recombinant Protein | PDCD10 recombinant protein

Recombinant Human Programmed cell death protein 10

Cat. Num. AAA1403715

• Gene Names: PDCD10; CCM3; TFAR15
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Programmed cell death protein 10; Recombinant Human Programmed cell death protein 10; Cerebral cavernous malformations 3 protein; TF-1 cell apoptosis-related protein 15; PDCD10 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-212aa; Full Length
• Sequence: MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
• Sequence Length: 212

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for PDCD10 recombinant protein

Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and STK26 activity. Important for cell migration, and for normal structure and assembly of the Golgi complex. Important for KDR/VEGFR2 signaling. Increases the stability of KDR/VEGFR2 and prevents its breakdown. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hatopoiesis during embryonic development.

Product Categories/Family for PDCD10 recombinant protein

Signal Transduction

References

cDNA cloning and expression of an apoptosis-related gene, human TFAR-15 gene.Wang Y.G., Liu H.T., Ma D.L., Zhang Y.M.Sci. China, Ser. C, Life Sci. 42:323-329(1999)

NCBI and Uniprot Product Information

• NCBI GI #: 20127517
• NCBI GeneID: 11235
• NCBI Accession #: NP_009148.2
• NCBI GenBank Nucleotide #: NM_007217.3
• UniProt Accession #: Q9BUL8; O14811; A8K515; D3DNN5
• Molecular Weight: 40.7 kDa
• NCBI Official Full Name: programmed cell death protein 10
• NCBI Official Synonym Full Names: programmed cell death 10
• NCBI Official Symbol: PDCD10
• NCBI Official Synonym Symbols: CCM3; TFAR15
• NCBI Protein Information: programmed cell death protein 10
• UniProt Protein Name: Programmed cell death protein 10
• Protein Family: Programmed cell death protein
• UniProt Gene Name: PDCD10
• UniProt Synonym Gene Names: CCM3; TFAR15
• UniProt Entry Name: PDC10_HUMAN

NCBI Description

This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

PDCD10: Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and MST4 activity. Important for cell migration, and for normal structure and assembly of the Golgi complex. Important for KDR/VEGFR2 signaling. Increases the stability of KDR/VEGFR2 and prevents its breakdown. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development. Defects in PDCD10 are the cause of cerebral cavernous malformations type 3 (CCM3). Cerebral cavernous malformations (CCMs) are congenital vascular anomalies of the central nervous system that can result in hemorrhagic stroke, seizures, recurrent headaches, and focal neurologic deficits. CCMs have an incidence of 0.1%-0.5% in the general population and usually present clinically during the 3rd to 5th decade of life. The lesions are characterized by grossly enlarged blood vessels consisting of a single layer of endothelium and without any intervening neural tissue, ranging in diameter from a few millimeters to several centimeters. Belongs to the PDCD10 family.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 3q26.1

Cellular Component: cytoplasm; cytosol; Golgi apparatus; Golgi membrane; plasma membrane

Molecular Function: protein binding; protein homodimerization activity; protein kinase binding; protein N-terminus binding

Biological Process: angiogenesis; establishment of Golgi localization; negative regulation of apoptosis; positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of MAP kinase activity; positive regulation of Notch signaling pathway; positive regulation of peptidyl-serine phosphorylation; positive regulation of stress-activated MAPK cascade; protein stabilization; regulation of Rho protein signal transduction; response to hydrogen peroxide; stress fiber formation

Disease: Cerebral Cavernous Malformations 3