CCM-3 recombinant protein

Human CCM-3

Cat. Num. AAA691618

• Gene Names: PDCD10; CCM3; TFAR15
• Reactivity: Human
• Purity: > 95% by SDS-PAGE & silver stain
• Synonyms: CCM-3; Human CCM-3; Recombinant Human CCM3; Cerebral cavernous malformations 3 protein; Programmed cell death protein 10; CCM3; CCM-3 recombinant protein

• Host: E Coli
• Reactivity: Human
• Purity/Purification: > 95% by SDS-PAGE & silver stain
• Form/Format: Lyophilized
• Sequence: MGSSHHHHHHSSGLVPRGSMRMTMEEMKNEAETTSMVSMPLYAVMYPVFN ELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLL RMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTI KDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTY FKDGKAINVFVSANRLIHQTNLILQTFKTVA
• Sequence Length: 231

• Buffer: PBS
• Preparation and Storage: Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted CCM-3 should be stored in working aliquots at -20 degree C.

Testing Data

Related Product Information for CCM-3 recombinant protein

Cerebral cavernous malformations (CCMs) are sporadically acquired or inherited vascular lesions of the central nervous system consisting of clusters of dilated thin-walled blood vessels that predispose individuals to seizures and stroke. Mutations in CCM1, CCM2, or CCM3 lead to cerebral cavernous malformations, one of the most common hereditary vascular diseases of the brain. Endothelial cells within these lesions are the main disease compartments. Here, we show that adenoviral CCM3 expression inhibits endothelial cell migration, proliferation, and tube formation while down regulation of endogenous CCM3 results in increased formation of tube-like structures. Adenoviral CCM3 expression does not induce apoptosis under normal endothelial cell culture conditions but protects endothelial cells from staurosporine-induced cell death. Tyrosine kinase activity profiling suggests that CCM3 supports PDPK-1/Akt-mediated endothelial cell quiescence and survival (Schleider et al, Neurogenetics 12, 2011). The CCM-3 is fused to a N-terminal His-tag (6x His).

Product Categories/Family for CCM-3 recombinant protein

Cytokines & Growth Factors

NCBI and Uniprot Product Information

• NCBI GI #: 20127517
• NCBI GeneID: 11235
• NCBI Accession #: NP_009148.2
• NCBI GenBank Nucleotide #: NM_007217.3
• UniProt Accession #: Q9BUL8; O14811; A8K515; D3DNN5
• Molecular Weight: 26.7 kDa
• NCBI Official Full Name: programmed cell death protein 10
• NCBI Official Synonym Full Names: programmed cell death 10
• NCBI Official Symbol: PDCD10
• NCBI Official Synonym Symbols: CCM3; TFAR15
• NCBI Protein Information: programmed cell death protein 10; apoptosis-related protein 15; TF-1 cell apoptosis-related protein 15; cerebral cavernous malformations 3 protein
• UniProt Protein Name: Programmed cell death protein 10
• Protein Family: Programmed cell death protein
• UniProt Gene Name: PDCD10
• UniProt Synonym Gene Names: CCM3; TFAR15
• UniProt Entry Name: PDC10_HUMAN

NCBI Description

This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and MST4 activity. Important for cell migration, and for normal structure and assembly of the Golgi complex. Important for KDR/VEGFR2 signaling. Increases the stability of KDR/VEGFR2 and prevents its breakdown. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development

By similarity. Ref.8 Ref.9 Ref.12

Subunit structure: Homodimer. Interacts (via C-terminus) with CCM2 and PXN. Interacts (via N-terminus) with MST4, STK24 and STK25. Interacts with GOLGA2. Identified in a complex with CCM1 and CCM2. Interacts with KDR/VEGFR2. Interaction with KDR/VEGFR2 is enhanced by stimulation with VEGFA

By similarity. Ref.9 Ref.10 Ref.12 Ref.15

Subcellular location: Cytoplasm. Golgi apparatus membrane; Peripheral membrane protein; Cytoplasmic side. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note: Partially co-localizes with endogenous PXN at the leading edges of migrating cells. Ref.9 Ref.12 Ref.15

Tissue specificity: Ubiquitous. Ref.8

Involvement in disease: Cerebral cavernous malformations 3 (CCM3) [MIM:603285]: A congenital vascular anomaly of the central nervous system that can result in hemorrhagic stroke, seizures, recurrent headaches, and focal neurologic deficits. The lesions are characterized by grossly enlarged blood vessels consisting of a single layer of endothelium and without any intervening neural tissue, ranging in diameter from a few millimeters to several centimeters.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.8

Sequence similarities: Belongs to the PDCD10 family.