Immunohistochemistry (IHC)
(Rabbit Anti-NIP7 antibodyParaffin Embedded Tissue: Human Lung cell Cellular Data: alveolar cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Rabbit NIP7 Polyclonal Antibody | anti-NIP7 antibody
NIP7 antibody - middle region
Gene Names
NIP7; KD93; CGI-37; HSPC031
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
NIP7; Polyclonal Antibody; NIP7 antibody - middle region; anti-NIP7 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKST
Sequence Length
180
Applicable Applications for anti-NIP7 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NIP7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-NIP7 antibodyParaffin Embedded Tissue: Human Lung cell Cellular Data: alveolar cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Immunohistochemistry (IHC)
(Rabbit Anti-NIP7 antibodyParaffin Embedded Tissue: Human Lung cell Cellular Data: alveolar cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Western Blot (WB)
(WB Suggested Anti-NIP7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: SW620 cell lysateNIP7 is supported by BioGPS gene expression data to be expressed in SW620)
Western Blot (WB)
(WB Suggested Anti-NIP7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: SW620 cell lysateNIP7 is supported by BioGPS gene expression data to be expressed in SW620)
Related Product Information for anti-NIP7 antibody
This is a rabbit polyclonal antibody against NIP7. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.
Target Description: NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.
Product Categories/Family for anti-NIP7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
60S ribosome subunit biogenesis protein NIP7 homolog isoform 1
NCBI Official Synonym Full Names
nucleolar pre-rRNA processing protein NIP7
NCBI Official Symbol
NIP7
NCBI Official Synonym Symbols
KD93; CGI-37; HSPC031
NCBI Protein Information
60S ribosome subunit biogenesis protein NIP7 homolog
UniProt Protein Name
60S ribosome subunit biogenesis protein NIP7 homolog
Protein Family
UniProt Gene Name
NIP7
UniProt Entry Name
NIP7_HUMAN
Uniprot Description
NIP7: Required for proper 34S pre-rRNA processing and 60S ribosome subunit assembly. Belongs to the NIP7 family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: RNA-binding; Nucleolus
Chromosomal Location of Human Ortholog: 16q22.1
Cellular Component: nucleolus
Molecular Function: protein binding
Biological Process: ribosome assembly
Research Articles on NIP7
Similar Products
Product Notes
The NIP7 nip7 (Catalog #AAA3205498) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NIP7 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NIP7 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the NIP7 nip7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGAEQSFLYG NHVLKSGLGR ITENTSQYQG VVVYSMADIP LGFGVAAKST. It is sometimes possible for the material contained within the vial of "NIP7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
