Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

XIAP-associated factor 1 (Xaf1) Recombinant Protein | Xaf1 recombinant protein

Recombinant Mouse XIAP-associated factor 1 (Xaf1)

Gene Names
Xaf1; Fbox39
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
XIAP-associated factor 1 (Xaf1); Recombinant Mouse XIAP-associated factor 1 (Xaf1); Xaf1 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-273, full length protein
Sequence
MEADFQVCRNCKRNVASLHFMLHEAHCLRFIVLCPECEEPIPESKMKEHMEVVHQQTKESQQHPAKCKFCELAVQLSNLDVHESHCGSRTEHCPHCNQPITLQVLSQHKAMCLSAKGRPEEGKRIVSSPGRKTRCDLCKQMIPENTYASHMKQCSAPNTVTRIRDESIIVIPSTLAFMDSGNRRSTVSKDVRPKTKNRNSSTKRETKKQNGTVALPLKSGLQQRADLPTGDETAYDTLQNCCQCRILLPLPILNEHQEKCQRLAHQKKLQWGW
Sequence Length
273
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,465 Da
NCBI Official Full Name
XIAP-associated factor 1 isoform 1
NCBI Official Synonym Full Names
XIAP associated factor 1
NCBI Official Symbol
Xaf1
NCBI Official Synonym Symbols
Fbox39
NCBI Protein Information
XIAP-associated factor 1
UniProt Protein Name
XIAP-associated factor 1
Protein Family
UniProt Gene Name
Xaf1
UniProt Synonym Gene Names
Birc4bp; Xiapaf1

Uniprot Description

Seems to function as a negative regulator of members of the IAP (inhibitor of apoptosis protein) family. Inhibits anti-caspase activity of BIRC4. Induces cleavage and inactivation of BIRC4 independent of caspase activation. Mediates TNF-alpha-induced apoptosis and is involved in apoptosis in trophoblast cells. May inhibit BIRC4 indirectly by activating the mitochondrial apoptosis pathway. After translocation to mitochondria, promotes translocation of BAX to mitochondria and cytochrome c release from mitochondria. Seems to promote the redistribution of BIRC4 from the cytoplasm to the nucleus, probably independent of BIRC4 inactivation which seems to occur in the cytoplasm. The BIRC4-XAF1 complex mediates down-regulation of BIRC5/survivin; the process requires the E3 ligase activity of BIRC4. Seems to be involved in cellular sensitivity to the proapoptotic actions of TRAIL. May be a tumor suppressor by mediating apoptosis resistance of cancer cells ().

Research Articles on Xaf1

Similar Products

Product Notes

The Xaf1 xaf1 (Catalog #AAA1370575) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-273, full length protein. The amino acid sequence is listed below: MEADFQVCRN CKRNVASLHF MLHEAHCLRF IVLCPECEEP IPESKMKEHM EVVHQQTKES QQHPAKCKFC ELAVQLSNLD VHESHCGSRT EHCPHCNQPI TLQVLSQHKA MCLSAKGRPE EGKRIVSSPG RKTRCDLCKQ MIPENTYASH MKQCSAPNTV TRIRDESIIV IPSTLAFMDS GNRRSTVSKD VRPKTKNRNS STKRETKKQN GTVALPLKSG LQQRADLPTG DETAYDTLQN CCQCRILLPL PILNEHQEKC QRLAHQKKLQ WGW. It is sometimes possible for the material contained within the vial of "XIAP-associated factor 1 (Xaf1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual