Western Blot (WB)
(Host: RabbitTarget Name: HACL1Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit HACL1 Polyclonal Antibody | anti-HACL1 antibody
HACL1 Antibody - N-terminal region
Gene Names
HACL1; HPCL; HPCL2; PHYH2; 2-HPCL
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HACL1; Polyclonal Antibody; HACL1 Antibody - N-terminal region; anti-HACL1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CWPLLVIGGSSERNQETMGAFQEFPQVEACRLYTKFSARPSSIEAIPFVI
Sequence Length
578
Applicable Applications for anti-HACL1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HACL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: HACL1Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: HACL1Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-HACL1 antibody
This is a rabbit polyclonal antibody against HACL1. It was validated on Western Blot
Target Description: HACL1 catalyzes a carbon-carbon cleavage reaction; It cleaves a 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde.
Target Description: HACL1 catalyzes a carbon-carbon cleavage reaction; It cleaves a 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde.
Product Categories/Family for anti-HACL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
2-hydroxyacyl-CoA lyase 1 isoform a
NCBI Official Synonym Full Names
2-hydroxyacyl-CoA lyase 1
NCBI Official Symbol
HACL1
NCBI Official Synonym Symbols
HPCL; HPCL2; PHYH2; 2-HPCL
NCBI Protein Information
2-hydroxyacyl-CoA lyase 1
UniProt Protein Name
2-hydroxyacyl-CoA lyase 1
Protein Family
UniProt Gene Name
HACL1
UniProt Synonym Gene Names
HPCL; HPCL2; PHYH2; 2-HPCL
UniProt Entry Name
HACL1_HUMAN
Uniprot Description
HACL1: Catalyzes a carbon-carbon cleavage reaction; cleaves a 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde. Belongs to the TPP enzyme family.
Protein type: EC 4.1.-.-; Lyase
Chromosomal Location of Human Ortholog: 3p25.1
Cellular Component: peroxisomal matrix; peroxisome
Molecular Function: carbon-carbon lyase activity; identical protein binding; magnesium ion binding; thiamin pyrophosphate binding; cofactor binding; receptor binding
Biological Process: cellular lipid metabolic process; protein oligomerization; fatty acid alpha-oxidation
Research Articles on HACL1
Similar Products
Product Notes
The HACL1 hacl1 (Catalog #AAA3217359) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HACL1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HACL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HACL1 hacl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CWPLLVIGGS SERNQETMGA FQEFPQVEAC RLYTKFSARP SSIEAIPFVI. It is sometimes possible for the material contained within the vial of "HACL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
