Gastricsin (PGC) Recombinant Protein | PGC recombinant protein
Recombinant Guinea pig Gastricsin (PGC)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gastricsin (PGC); Recombinant Guinea pig Gastricsin (PGC); PGC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
66-394, Full length protein
Sequence
SVLYEPMSYMDAAYFGQISLGTPPQSFQVLFDTGSSNLWVPSVYCSSLACTTHTRFNPRDSSTYVATDQSFSLEYGTGSLTGVFGYDTMTIQDIQVPKQEFGLSETEPGSDFVYAEFDGILGLGYPGLSEGGATTAMQGLLREGALSQSLFSVYLGSQQGSDEGQLILGGVDESLYTGDIYWTPVTQELYWQIGIEGFLIDGSASGWCSRGCQGIVDTGTSLLTVPSDYLSTLVQAIGAEENEYGEYFVSCSSIQDLPTLTFVISGVEFPLSPSAYILSGENYCMVGLESTYVSPGGGEPVWILGDVFLRSYYSVYDLANNRVGFATAA
Sequence Length
329
Species
Cavia porcellus (Guinea pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for PGC recombinant protein
This gene encodes an aspartic proteinase that belongs to the peptidase family A1. The encoded protein is a digestive enzyme that is produced in the stomach and constitutes a major component of the gastric mucosa. This protein is also secreted into the serum. This protein is synthesized as an inactive zymogen that includes a highly basic prosegment. This enzyme is converted into its active mature form at low pH by sequential cleavage of the prosegment that is carried out by the enzyme itself. Polymorphisms in this gene are associated with susceptibility to gastric cancers. Serum levels of this enzyme are used as a biomarker for certain gastric diseases including Helicobacter pylori related gastritis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 1.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,996 Da
NCBI Official Full Name
gastricsin preproprotein
NCBI Official Symbol
Pgc
NCBI Protein Information
gastricsin
UniProt Protein Name
Gastricsin
Protein Family
UniProt Gene Name
PGC
Uniprot Description
Hydrolyzes a variety of proteins.
Similar Products
Product Notes
The PGC pgc (Catalog #AAA1333639) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 66-394, Full length protein. The amino acid sequence is listed below: SVLYEPMSYM DAAYFGQISL GTPPQSFQVL FDTGSSNLWV PSVYCSSLAC TTHTRFNPRD SSTYVATDQS FSLEYGTGSL TGVFGYDTMT IQDIQVPKQE FGLSETEPGS DFVYAEFDGI LGLGYPGLSE GGATTAMQGL LREGALSQSL FSVYLGSQQG SDEGQLILGG VDESLYTGDI YWTPVTQELY WQIGIEGFLI DGSASGWCSR GCQGIVDTGT SLLTVPSDYL STLVQAIGAE ENEYGEYFVS CSSIQDLPTL TFVISGVEFP LSPSAYILSG ENYCMVGLES TYVSPGGGEP VWILGDVFLR SYYSVYDLAN NRVGFATAA. It is sometimes possible for the material contained within the vial of "Gastricsin (PGC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
