Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Chromodomain-helicase-DNA-binding protein 7 (Chd7) Recombinant Protein | Chd7 recombinant protein

Recombinant Mouse Chromodomain-helicase-DNA-binding protein 7 (Chd7) , partial

Gene Names
Chd7; Dz; Mt; Cyn; Edy; Flo; Lda; Obt; Whi; Cycn; Todo; WBE1; metis; GENA 47; GENA 60; Gena 52; A730019I05Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chromodomain-helicase-DNA-binding protein 7 (Chd7); Recombinant Mouse Chromodomain-helicase-DNA-binding protein 7 (Chd7); partial; Chd7 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
708-970; Partial.
Sequence
KTEGSENSDLDKTPPPSPAPEEDEDPGVQKRRSSRQVKRKRYTEDLEFKISDEEA DDADAAGRDSPSNTSQSEQQESVDAEGPVVEKIMSSRLVKKQKESGEEVEVEEF YVKYKNFSYLHCQWASVEDLEKDKRIQQKIKRFKSKQGQSKFLSEIEDDLFNPDYV EVDRIMDFARSTDDRGEPVIHYLVKWCSLPYEDSTWELKQDIDQTKIEEFEKLMSR EPETERVERPPADDWKKSESSREYKNNNKLREYQLEGVNWLL
Sequence Length
970
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Chd7 recombinant protein
This gene encodes a protein that contains several helicase family domains. Mutations in this gene have been found in some patients with the CHARGE syndrome.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
331,195 Da
NCBI Official Full Name
chromodomain-helicase-DNA-binding protein 7 isoform 1
NCBI Official Synonym Full Names
chromodomain helicase DNA binding protein 7
NCBI Official Symbol
Chd7
NCBI Official Synonym Symbols
Dz; Mt; Cyn; Edy; Flo; Lda; Obt; Whi; Cycn; Todo; WBE1; metis; GENA 47; GENA 60; Gena 52; A730019I05Rik
NCBI Protein Information
chromodomain-helicase-DNA-binding protein 7
UniProt Protein Name
Chromodomain-helicase-DNA-binding protein 7
UniProt Gene Name
Chd7
UniProt Synonym Gene Names
CHD-7

NCBI Description

This gene encodes a protein containing two chromodomains and an ATP-binding helicase domain that functions as a regulator of transcription. Mutations in this gene result in an array of development defects, including inner ear problems. Mice defective for this gene exhibit many of the clinical features of the CHARGE syndrome caused by mutations in the homologous gene in human. [provided by RefSeq, Sep 2015]

Uniprot Description

Probable transcription regulator. Maybe involved in the in 45S precursor rRNA production ().

Research Articles on Chd7

Similar Products

Product Notes

The Chd7 chd7 (Catalog #AAA1203435) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 708-970; Partial. The amino acid sequence is listed below: KTEGSENSDL DKTPPPSPAP EEDEDPGVQK RRSSRQVKRK RYTEDLEFKI SDEEA DDADAAGRDS PSNTSQSEQQ ESVDAEGPVV EKIMSSRLVK KQKESGEEVE VEEF YVKYKNFSYL HCQWASVEDL EKDKRIQQKI KRFKSKQGQS KFLSEIEDDL FNPDYV EVDRIMDFAR STDDRGEPVI HYLVKWCSLP YEDSTWELKQ DIDQTKIEEF EKLMSR EPETERVERP PADDWKKSES SREYKNNNKL REYQLEGVNW LL . It is sometimes possible for the material contained within the vial of "Chromodomain-helicase-DNA-binding protein 7 (Chd7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.