Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Envelope protein US9 (ORF65) Recombinant Protein | ORF65 recombinant protein

Recombinant Varicella-zoster virus Envelope protein US9 (ORF65)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Envelope protein US9 (ORF65); Recombinant Varicella-zoster virus Envelope protein US9 (ORF65); Recombinant Envelope protein US9 (ORF65); Envelope protein US9; Envelope protein 65 ORF65 protein; ORF65 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-102
Sequence
MAGQNTMEGEAVALLMEAVVTPRAQPNNTTITAIQPSRSAEKCYYSDSENETADEFLRRIGKYQHKIYHRKKFCYITLIIVFVFAMTGAAFALGYITSQFVG
Sequence Length
102
Species
Varicella-zoster virus (strain Dumas) (HHV-3) (Human herpesvirus 3)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,436 Da
NCBI Official Full Name
membrane protein US9
NCBI Official Symbol
ORF65
NCBI Protein Information
type 2 membrane protein; tegument-associated; localizes envelope proteins; membrane protein US9
UniProt Protein Name
Envelope protein US9
UniProt Entry Name
US9_VZVD

Uniprot Description

Function: Essential for the anterograde spread of the infection throughout the host nervous system. Together with the gE/gI heterodimer, US9 is involved in the sorting and transport of viral structural components toward axon tips.

Subcellular location: Virion membrane; Single-pass type II membrane protein

By similarity. Host Golgi apparatus membrane; Single-pass type II membrane protein. Host smooth endoplasmic reticulum membrane; Single-pass type II membrane protein

By similarity. Host cell membrane; Single-pass type II membrane protein

Potential. Note: During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN), maybe through an interaction with PACS-1 sorting protein. Ref.3 Ref.4

Post-translational modification: Phosphorylated on serines within the acidic cluster, possibly by host CK2

Potential. Phosphorylation determines whether endocytosed viral US9 traffics to the trans-Golgi network or recycles to the cell membrane

Potential. Ref.3

Sequence similarities: Belongs to the alphaherpesvirinae envelope protein US9 family.

Similar Products

Product Notes

The ORF65 (Catalog #AAA1153402) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-102. The amino acid sequence is listed below: MAGQNTMEGE AVALLMEAVV TPRAQPNNTT ITAIQPSRSA EKCYYSDSEN ETADEFLRRI GKYQHKIYHR KKFCYITLII VFVFAMTGAA FALGYITSQF VG. It is sometimes possible for the material contained within the vial of "Envelope protein US9 (ORF65), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.