Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Retinal dehydrogenase 2 (ALDH1A2) Recombinant Protein | ALDH1A2 recombinant protein

Recombinant Human Retinal dehydrogenase 2 (ALDH1A2)

Gene Names
ALDH1A2; RALDH2; RALDH2-T; RALDH(II)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Retinal dehydrogenase 2 (ALDH1A2); Recombinant Human Retinal dehydrogenase 2 (ALDH1A2); Retinal dehydrogenase 2; RALDH 2; RalDH2; EC=1.2.1.36; Aldehyde dehydrogenase family 1 member A2; Retinaldehyde-specific dehydrogenase type 2; RALDH(II); ALDH1A2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-518aa; Full Length
Sequence
MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
Species
Homo sapiens (Human)
Production Note
Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

SDS-Page

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58.7 kDa
NCBI Official Full Name
retinal dehydrogenase 2 isoform 4
NCBI Official Synonym Full Names
aldehyde dehydrogenase 1 family, member A2
NCBI Official Symbol
ALDH1A2
NCBI Official Synonym Symbols
RALDH2; RALDH2-T; RALDH(II)
NCBI Protein Information
retinal dehydrogenase 2; RALDH 2; retinaldehyde-specific dehydrogenase type 2
UniProt Protein Name
Retinal dehydrogenase 2
Protein Family
UniProt Gene Name
ALDH1A2
UniProt Synonym Gene Names
RALDH2; RALDH 2; RalDH2; RALDH(II)
UniProt Entry Name
AL1A2_HUMAN

NCBI Description

This protein belongs to the aldehyde dehydrogenase family of proteins. The product of this gene is an enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. Retinoic acid, the active derivative of vitamin A (retinol), is a hormonal signaling molecule that functions in developing and adult tissues. The studies of a similar mouse gene suggest that this enzyme and the cytochrome CYP26A1, concurrently establish local embryonic retinoic acid levels which facilitate posterior organ development and prevent spina bifida. Four transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, May 2011]

Uniprot Description

ALDH1A2: Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Does metabolize octanal and decanal but does not metabolize citral, benzaldehyde, acetaldehyde and propanal efficiently. Belongs to the aldehyde dehydrogenase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cofactor and Vitamin Metabolism - retinol; Oxidoreductase; EC 1.2.1.36

Chromosomal Location of Human Ortholog: 15q21.3

Cellular Component: perinuclear region of cytoplasm; cytoplasm; cytosol

Molecular Function: aldehyde dehydrogenase (NAD) activity; 3-chloroallyl aldehyde dehydrogenase activity; retinal binding; retinal dehydrogenase activity

Biological Process: heart morphogenesis; embryonic forelimb morphogenesis; neural tube development; retinoic acid receptor signaling pathway; retinal metabolic process; neural crest cell development; positive regulation of apoptosis; vitamin A metabolic process; response to estradiol stimulus; response to vitamin A; neuron differentiation; anterior/posterior pattern formation; negative regulation of cell proliferation; morphogenesis of embryonic epithelium; retinol metabolic process; positive regulation of cell proliferation; determination of bilateral symmetry; pancreas development; retinoic acid metabolic process; kidney development; embryonic gut development; proximal/distal pattern formation; hindbrain development; cardiac muscle development; blood vessel development; regulation of endothelial cell proliferation; liver development; embryonic camera-type eye development; pituitary gland development; response to cytokine stimulus; 9-cis-retinoic acid biosynthetic process; midgut development; lung development

Research Articles on ALDH1A2

Similar Products

Product Notes

The ALDH1A2 aldh1a2 (Catalog #AAA1005929) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-518aa; Full Length. The amino acid sequence is listed below: MTSSKIEMPG EVKADPAALM ASLHLLPSPT PNLEIKYTKI FINNEWQNSE SGRVFPVYNP ATGEQVCEVQ EADKADIDKA VQAARLAFSL GSVWRRMDAS ERGRLLDKLA DLVERDRAVL ATMESLNGGK PFLQAFYVDL QGVIKTFRYY AGWADKIHGM TIPVDGDYFT FTRHEPIGVC GQIIPWNFPL LMFAWKIAPA LCCGNTVVIK PAEQTPLSAL YMGALIKEAG FPPGVINILP GYGPTAGAAI ASHIGIDKIA FTGSTEVGKL IQEAAGRSNL KRVTLELGGK SPNIIFADAD LDYAVEQAHQ GVFFNQGQCC TAGSRIFVEE SIYEEFVRRS VERAKRRVVG SPFDPTTEQG PQIDKKQYNK ILELIQSGVA EGAKLECGGK GLGRKGFFIE PTVFSNVTDD MRIAKEEIFG PVQEILRFKT MDEVIERANN SDFGLVAAVF TNDINKALTV SSAMQAGTVW INCYNALNAQ SPFGGFKMSG NGREMGEFGL REYSEVKTVT VKIPQKNS . It is sometimes possible for the material contained within the vial of "Retinal dehydrogenase 2 (ALDH1A2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.