Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NIT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateNIT1 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit NIT1 Polyclonal Antibody | anti-NIT1 antibody

NIT1 antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NIT1; Polyclonal Antibody; NIT1 antibody - N-terminal region; anti-NIT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC
Sequence Length
327
Applicable Applications for anti-NIT1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Pig: 93%; Rabbit: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NIT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NIT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateNIT1 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (WB Suggested Anti-NIT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateNIT1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-NIT1 antibody
This is a rabbit polyclonal antibody against NIT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NIT1 play a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. NIT1 has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tum
Product Categories/Family for anti-NIT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
deaminated glutathione amidase isoform 1
NCBI Official Synonym Full Names
nitrilase 1
NCBI Official Symbol
NIT1
NCBI Protein Information
deaminated glutathione amidase
UniProt Protein Name
Nitrilase homolog 1
Protein Family
UniProt Gene Name
NIT1
UniProt Entry Name
NIT1_HUMAN

NCBI Description

This gene encodes a member of the nitrilase protein family with homology to bacterial and plant nitrilases, enzymes that cleave nitriles and organic amides to the corresponding carboxylic acids plus ammonia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

NIT1: Plays a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. Has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tumor suppressor activity of FHIT. It is also a negative regulator of primary T-cells. Has apparently no omega-amidase activity such as NIT2. Belongs to the UPF0012 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.5.-.-; Hydrolase

Chromosomal Location of Human Ortholog: 1q21-q22

Cellular Component: mitochondrion; nucleus

Molecular Function: nitrilase activity

Biological Process: nitrogen compound metabolic process

Research Articles on NIT1

Similar Products

Product Notes

The NIT1 nit1 (Catalog #AAA3212901) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NIT1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NIT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NIT1 nit1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VREAARLGAC LAFLPEAFDF IARDPAETLH LSEPLGGKLL EEYTQLAREC. It is sometimes possible for the material contained within the vial of "NIT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.