E3 ubiquitin-protein ligase ZNRF1 (Znrf1) Recombinant Protein | Znrf1 recombinant protein
Recombinant Mouse E3 ubiquitin-protein ligase ZNRF1 (Znrf1)
Gene Names
Znrf1; Rnf42; Zrfp1; nin283; B830022L21Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase ZNRF1 (Znrf1); Recombinant Mouse E3 ubiquitin-protein ligase ZNRF1 (Znrf1); Znrf1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-227, full length protein
Sequence
GGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMDPSTAGGVPFSLYTPASRGTGDSERAPGGGGSTSDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKDAGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHPAD
Sequence Length
226
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Znrf1 recombinant protein
In a study identifying genes in rat that are upregulated in response to nerve damage, a gene which is highly expressed in ganglia and in the central nervous system was found. The protein encoded by the rat gene contains both a zinc finger and a RING finger motif and is localized in the endosome
lysosome compartment, indicating that it may be involved in ubiquitin-mediated protein modification. The protein encoded by this human gene is highly similar in sequence to that encoded by the rat gene.
lysosome compartment, indicating that it may be involved in ubiquitin-mediated protein modification. The protein encoded by this human gene is highly similar in sequence to that encoded by the rat gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23,843 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase ZNRF1 isoform a
NCBI Official Synonym Full Names
zinc and ring finger 1
NCBI Official Symbol
Znrf1
NCBI Official Synonym Symbols
Rnf42; Zrfp1; nin283; B830022L21Rik
NCBI Protein Information
E3 ubiquitin-protein ligase ZNRF1
UniProt Protein Name
E3 ubiquitin-protein ligase ZNRF1
Protein Family
UniProt Gene Name
Znrf1
UniProt Synonym Gene Names
Nin283
Uniprot Description
E3 ubiquitin-protein ligase that mediates the ubiquitination of AKT1 and GLUL, thereby playing a role in neuron cells differentiation. Plays a role in the establishment and maintenance of neuronal transmission and plasticity. Regulates Schwann cells differentiation by mediating ubiquitination of GLUL. Promotes Wallerian degeneration, a neurodegeneration disorder, by mediating 'Lys-48'-linked polyubiquitination and subsequent degradation of AKT1 in axons: degradation of AKT1 prevents AKT1-mediated phosphorylation of GSK3B, leading to GSK3B activation and phosphorylation of DPYSL2/CRMP2 followed by destabilization of microtubule assembly in axons.
Research Articles on Znrf1
Similar Products
Product Notes
The Znrf1 znrf1 (Catalog #AAA1282248) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-227, full length protein. The amino acid sequence is listed below: GGKQSTAARS RGPFPGVSTD DSAVPPPGGA PHFGHYRTGG GAMGLRSRSV SSVAGMGMDP STAGGVPFSL YTPASRGTGD SERAPGGGGS TSDSTYAHGN GYQETGGGHH RDGMLYLGSR ASLADALPLH IAPRWFSSHS GFKCPICSKS VASDEMEMHF IMCLSKPRLS YNDDVLTKDA GECVICLEEL LQGDTIARLP CLCIYHKSCI DSWFEVNRSC PEHPAD. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase ZNRF1 (Znrf1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
