SDS-PAGE
Zinc finger protein 346 Recombinant Protein | Znf346 recombinant protein
Recombinant Mouse Zinc finger protein 346
Gene Names
Zfp346; Jaz; Znf346
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zinc finger protein 346; Recombinant Mouse Zinc finger protein 346; Just another zinc finger protein; Znf346 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-294aa; Full Length
Sequence
MECPAPDATDAADPGEAGPYKGSEEPEGREPDGVRFDRERARRLWEAVSGAQPAGREEVEHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETIKGDVKRLDSDQKSSRSKDKNHCCPICNMTFSSPAVAQSHYLGKTHAKSLKLKQQSTKGAALQQNREMLDPDKFCSLCHSTFNDPAMAQQHYMGKRHRKQETKLKLMAHYGRLADPAVSDLPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTLVTLGSQTPVQTQPTPKDSSTVQD
Sequence Length
294
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Znf346 recombinant protein
Binds with low affinity to dsDNA and ssRNA, and with high affinity to dsRNA, with no detectable sequence specificity.
References
"JAZ requires the double-stranded RNA-binding zinc finger motifs for nuclear localization."
Yang M., May W.S., Ito T.
J. Biol. Chem. 274:27399-27406(1999)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48.7 kDa
NCBI Official Full Name
zinc finger protein 346
NCBI Official Synonym Full Names
zinc finger protein 346
NCBI Official Symbol
Zfp346
NCBI Official Synonym Symbols
Jaz; Znf346
NCBI Protein Information
zinc finger protein 346
UniProt Protein Name
Zinc finger protein 346
Protein Family
UniProt Gene Name
Znf346
UniProt Synonym Gene Names
Jaz; Zfp346
UniProt Entry Name
ZN346_MOUSE
Uniprot Description
ZNF346: Binds to dsRNA and DNA. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Nucleolus
Cellular Component: cytoplasm; intracellular; nucleolus; nucleus
Molecular Function: double-stranded RNA binding; enzyme binding; metal ion binding; nucleic acid binding; p53 binding; protein binding; RNA binding; zinc ion binding
Biological Process: positive regulation of apoptosis
Research Articles on Znf346
Similar Products
Product Notes
The Znf346 znf346 (Catalog #AAA1334387) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-294aa; Full Length. The amino acid sequence is listed below: MECPAPDATD AADPGEAGPY KGSEEPEGRE PDGVRFDRER ARRLWEAVSG AQPAGREEVE HMIQKNQCLF TSTQCKVCCA MLISESQKLA HYQSKKHANK VKRYLAIHGM ETIKGDVKRL DSDQKSSRSK DKNHCCPICN MTFSSPAVAQ SHYLGKTHAK SLKLKQQSTK GAALQQNREM LDPDKFCSLC HSTFNDPAMA QQHYMGKRHR KQETKLKLMA HYGRLADPAV SDLPAGKGYP CKTCKIVLNS IEQYQAHVSG FKHKNQSPKT LVTLGSQTPV QTQPTPKDSS TVQD. It is sometimes possible for the material contained within the vial of "Zinc finger protein 346, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
