Probable palmitoyltransferase ZDHHC21 (Zdhhc21) Recombinant Protein | Zdhhc21 recombinant protein
Recombinant Mouse Probable palmitoyltransferase ZDHHC21 (Zdhhc21)
Gene Names
Zdhhc21; dep; AL024349; 9130404H11Rik; D130004H04Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable palmitoyltransferase ZDHHC21 (Zdhhc21); Recombinant Mouse Probable palmitoyltransferase ZDHHC21 (Zdhhc21); Zdhhc21 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-265aa; full length protein
Sequence
MGLRIHFVVDPHGWCCMGLIVFVWLYNIVIIPKIVLFPHYEEGHIPGILIIIFYGISIFC LVALVRASLTDPGRLPENPKIPHAERELWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHC PWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNLDLFVVRHELAIM RLAAFMGITMLVGITGLFYTQLIGIITDTTSIEKMSNCCEEISRPRKPWQQTFSEVFGTR WKILWFIPFRQRQPLRVPYHFANHV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Zdhhc21 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31,331 Da
NCBI Official Full Name
probable palmitoyltransferase ZDHHC21
NCBI Official Synonym Full Names
zinc finger, DHHC domain containing 21
NCBI Official Symbol
Zdhhc21
NCBI Official Synonym Symbols
dep; AL024349; 9130404H11Rik; D130004H04Rik
NCBI Protein Information
probable palmitoyltransferase ZDHHC21
UniProt Protein Name
Probable palmitoyltransferase ZDHHC21
Protein Family
UniProt Gene Name
Zdhhc21
UniProt Synonym Gene Names
Gramp3; DHHC-21
UniProt Entry Name
ZDH21_MOUSE
Uniprot Description
ZDHHC21: Palmitoylates sex steroid hormone receptors, including ESR1, PGR and AR, thereby regulating their targeting to the plasma membrane. This affects rapid intracellular signaling by sex hormones via ERK and AKT kinases and the generation of cAMP, but does not affect that mediated by their nuclear receptor. Belongs to the DHHC palmitoyltransferase family.
Protein type: Transferase; EC 2.3.1.225; Membrane protein, integral; Membrane protein, multi-pass
Cellular Component: Golgi apparatus; integral to membrane; membrane; plasma membrane
Molecular Function: metal ion binding; palmitoyltransferase activity; protein-cysteine S-palmitoleyltransferase activity; transferase activity; transferase activity, transferring acyl groups; zinc ion binding
Biological Process: hair follicle development; peptidyl-S-palmitoyl-L-cysteine biosynthetic process from peptidyl-cysteine; protein palmitoylation; sebaceous gland development
Research Articles on Zdhhc21
Similar Products
Product Notes
The Zdhhc21 zdhhc21 (Catalog #AAA7035691) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-265aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Zdhhc21 zdhhc21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGLRIHFVVD PHGWCCMGLI VFVWLYNIVI IPKIVLFPHY EEGHIPGILI IIFYGISIFC LVALVRASLT DPGRLPENPK IPHAERELWE LCNKCNLMRP KRSHHCSRCG HCVRRMDHHC PWINNCVGED NHWLFLQLCF YTELLTCYAL MFSFCHYYYF LPLKKRNLDL FVVRHELAIM RLAAFMGITM LVGITGLFYT QLIGIITDTT SIEKMSNCCE EISRPRKPWQ QTFSEVFGTR WKILWFIPFR QRQPLRVPYH FANHV. It is sometimes possible for the material contained within the vial of "Probable palmitoyltransferase ZDHHC21 (Zdhhc21), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
