Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin-11 (IL11) Active Protein | IL11 active protein

Recombinant Human Interleukin-11 (IL11), Partial

Gene Names
IL11; AGIF; IL-11
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-11 (IL11); Recombinant Human Interleukin-11 (IL11); Partial; Interleukin-11; IL-11; Adipogenesis Inhibitory Factor; AGIF; Oprelvekin; IL11; IL11 active protein
Ordering
For Research Use Only!
Host
Yeast
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 2% Glycine, pH 7.2
Sequence Positions
23-199aa; Partial
Sequence
GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Sequence Length
120
Species
Human
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using murine 7TD1 cells is typically 0.2 ng/mL
Subcellular Location
Secreted
Protein Families
IL-6 Superfamily
Classification
Cytokine
Subdivision
Interleukin
Pathway
Jak-STAT Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for IL11 active protein
Relevance: Interleukin 11 (IL-11) is a member of a family of human growth factors that includes human growth hormone, granulocyte colony-stimulating factor, and other growth factors. IL-11 is a thrombopoietic growth factor that directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. It also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2, It activates a signaling cascade that promotes cell proliferation. The signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3.

Function: Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production.
Product Categories/Family for IL11 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19 kDa
NCBI Official Full Name
interleukin-11 isoform 2
NCBI Official Synonym Full Names
interleukin 11
NCBI Official Symbol
IL11
NCBI Official Synonym Symbols
AGIF; IL-11
NCBI Protein Information
interleukin-11
UniProt Protein Name
Interleukin-11
Protein Family
UniProt Gene Name
IL11
UniProt Synonym Gene Names
IL-11; AGIF
UniProt Entry Name
IL11_HUMAN

NCBI Description

The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jun 2012]

Uniprot Description

IL11: Directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Belongs to the IL-6 superfamily.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Cytokine; Cell cycle regulation

Chromosomal Location of Human Ortholog: 19q13.3-q13.4

Cellular Component: extracellular space; cytoplasm; extracellular region

Molecular Function: growth factor activity; cytokine activity; interleukin-11 receptor binding

Biological Process: fat cell differentiation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of MAPKKK cascade; cell-cell signaling; megakaryocyte differentiation; B cell differentiation; negative regulation of hormone secretion; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of peptidyl-serine phosphorylation

Research Articles on IL11

Similar Products

Product Notes

The IL11 il11 (Catalog #AAA7115055) is an Active Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-199aa; Partial. The amino acid sequence is listed below: GPPPGPPRVS PDPRAELDST VLLTRSLLAD TRQLAAQLRD KFPADGDHNL DSLPTLAMSA GALGALQLPG VLTRLRADLL SYLRHVQWLR RAGGSSLKTL EPELGTLQAR LDRLLRRLQL LMSRLALPQP PPDPPAPPLA PPSSAWGGIR AAHAILGGLH LTLDWAVRGL LLLKTRL. It is sometimes possible for the material contained within the vial of "Interleukin-11 (IL11), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.