Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human IL-11 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

IL-11 recombinant protein

Recombinant Human IL-11 Protein

Gene Names
IL11; AGIF; IL-11
Purity
>95% by SDS-PAGE.
Synonyms
IL-11; Recombinant Human IL-11 Protein; Interleukin-11; Adipogenesis Inhibitory Factor; AGIF; Oprelvekin; IL11; IL-11 recombinant protein
Ordering
For Research Use Only!
Host
P.Pichia
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20mM PB, 2% Glycine, pH 7.2.
Sequence
GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Sequence Length
120
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IL-11 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human IL-11 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for IL-11 recombinant protein
Description: Recombinant Human IL-11 Protein is produced by P.Pichia expression system. The target protein is expressed with sequence (Gly23-Leu199) of human IL-11 (Accession #P20809).

Background: Interleukin 11 (IL-11) is a member of a family of human growth factors that includes human growth hormone,granulocyte colony-stimulating factor, and other growth factors. IL-11 is a thrombopoietic growth factor thatdirectly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells andinduces megakaryocyte maturation resulting in increased platelet production. It also promotes theproliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and eitherIL11RA1 or IL11RA2, It activates a signaling cascade that promotes cell proliferation. The signaling leads to theactivation of intracellular protein kinases and the phosphorylation of STAT3.
Product Categories/Family for IL-11 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-11 isoform 2
NCBI Official Synonym Full Names
interleukin 11
NCBI Official Symbol
IL11
NCBI Official Synonym Symbols
AGIF; IL-11
NCBI Protein Information
interleukin-11
UniProt Protein Name
Interleukin-11
UniProt Gene Name
IL11
UniProt Synonym Gene Names
IL-11; AGIF
UniProt Entry Name
IL11_HUMAN

NCBI Description

The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jun 2012]

Uniprot Description

IL11: Directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Belongs to the IL-6 superfamily.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Cytokine; Cell cycle regulation

Chromosomal Location of Human Ortholog: 19q13.3-q13.4

Cellular Component: extracellular space; cytoplasm; extracellular region

Molecular Function: growth factor activity; cytokine activity; interleukin-11 receptor binding

Biological Process: fat cell differentiation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of MAPKKK cascade; cell-cell signaling; megakaryocyte differentiation; B cell differentiation; negative regulation of hormone secretion; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of peptidyl-serine phosphorylation

Research Articles on IL-11

Similar Products

Product Notes

The IL-11 il11 (Catalog #AAA9139907) is a Recombinant Protein produced from P.Pichia and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: GPPPGPPRVS PDPRAELDST VLLTRSLLAD TRQLAAQLRD KFPADGDHNL DSLPTLAMSA GALGALQLPG VLTRLRADLL SYLRHVQWLR RAGGSSLKTL EPELGTLQAR LDRLLRRLQL LMSRLALPQP PPDPPAPPLA PPSSAWGGIR AAHAILGGLH LTLDWAVRGL LLLKTRL. It is sometimes possible for the material contained within the vial of "IL-11, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.