Werner syndrome ATP-dependent helicase homolog (Wrn) Recombinant Protein | Wrn recombinant protein

Recombinant Mouse Werner syndrome ATP-dependent helicase homolog (Wrn) , partial

Cat. Num. AAA1066596

• Gene Names: Wrn; AI846146
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Werner syndrome ATP-dependent helicase homolog (Wrn); Recombinant Mouse Werner syndrome ATP-dependent helicase homolog (Wrn); partial; Wrn recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 713-866; Helicase C-terminal domain
• Sequence: DLKPFLVRKASSAWEFEGPTIIYCPSRKMTEQVTAELGKLNLACRTYHAGMKISERKDVHHRFLRDEIQCVVATVAFGMGINKADIRKVIHYGAPKEMESYYQEIGRAGRDGLQSSCHLLWAPADFNTSRNLLIEIHDEKFRLYKLKMMVKMEK
• Sequence Length: 866

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Wrn recombinant protein

This gene encodes a member of the RecQ subfamily and the DEAH (Asp-Glu-Ala-His) subfamily of DNA and RNA helicases. DNA helicases are involved in many aspects of DNA metabolism, including transcription, replication, recombination, and repair. This protein contains a nuclear localization signal in the C-terminus and shows a predominant nucleolar localization. It possesses an intrinsic 3 to 5 DNA helicase activity, and is also a 3 to 5 exonuclease. Based on interactions between this protein and Ku70
80 heterodimer in DNA end processing, this protein may be involved in the repair of double strand DNA breaks. Defects in this gene are the cause of Werner syndrome, an autosomal recessive disorder characterized by premature aging.

NCBI and Uniprot Product Information

• NCBI GI #: 170763504
• NCBI GeneID: 22427
• NCBI Accession #: NP_001116294.1
• NCBI GenBank Nucleotide #: NM_001122822.1
• UniProt Accession #: O09053; O09050; Q80YP9; Q9JKD4; Q9Z241; Q9Z242
• Molecular Weight: 157,204 Da
• NCBI Official Full Name: Werner syndrome ATP-dependent helicase homolog
• NCBI Official Synonym Full Names: Werner syndrome RecQ like helicase
• NCBI Official Symbol: Wrn
• NCBI Official Synonym Symbols: AI846146
• NCBI Protein Information: Werner syndrome ATP-dependent helicase homolog
• UniProt Protein Name: Werner syndrome ATP-dependent helicase homolog
• Protein Family: Werner syndrome ATP-dependent helicase
• UniProt Gene Name: Wrn

Uniprot Description

Multifunctional enzyme that has both magnesium and ATP-dependent DNA-helicase activity and 3'->5' exonuclease activity towards double-stranded DNA with a 5'-overhang. Has no nuclease activity towards single-stranded DNA or blunt-ended double-stranded DNA. Binds preferentially to DNA substrates containing alternate secondary structures, such as replication forks and Holliday junctions. May play an important role in the dissociation of joint DNA molecules that can arise as products of homologous recombination, at stalled replication forks or during DNA repair. Alleviates stalling of DNA polymerases at the site of DNA lesions. Important for genomic integrity. Plays a role in the formation of DNA replication focal centers; stably associates with foci elements generating binding sites for RP-A (). Plays a role in double-strand break repair after gamma-irradiation ().