Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WRN monoclonal antibody (M06), clone 2F7. Western Blot analysis of WRN expression in Jurkat.)

Mouse WRN Monoclonal Antibody | anti-WRN antibody

WRN (Werner Syndrome, DKFZp686C2056, RECQ3, RECQL2, RECQL3) (Biotin)

Gene Names
WRN; RECQ3; RECQL2; RECQL3
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
WRN; Monoclonal Antibody; WRN (Werner Syndrome; DKFZp686C2056; RECQ3; RECQL2; RECQL3) (Biotin); Werner Syndrome; RECQL3; anti-WRN antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F7
Specificity
Recognizes WRN.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-WRN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
WRN (NP_000544, 1322aa-1432aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NPPVNSDMSKISLIRMLAPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(WRN monoclonal antibody (M06), clone 2F7. Western Blot analysis of WRN expression in Jurkat.)

Western Blot (WB) (WRN monoclonal antibody (M06), clone 2F7. Western Blot analysis of WRN expression in Jurkat.)
Related Product Information for anti-WRN antibody
This gene encodes a member of the RecQ subfamily and the DEAH (Asp-Glu-Ala-His) subfamily of DNA and RNA helicases. DNA helicases are involved in many aspects of DNA metabolism, including transcription, replication, recombination, and repair. This protein contains a nuclear localization signal in the C-terminus and shows a predominant nucleolar localization. It possesses an intrinsic 3' to 5' DNA helicase activity, and is also a 3' to 5' exonuclease. Based on interactions between this protein and Ku70/80 heterodimer in DNA end processing, this protein may be involved in the repair of double strand DNA breaks. Defects in this gene are the cause of Werner syndrome, an autosomal recessive disorder characterized by premature aging. [provided by RefSeq]
Product Categories/Family for anti-WRN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
162,461 Da
NCBI Official Full Name
Werner syndrome ATP-dependent helicase
NCBI Official Synonym Full Names
Werner syndrome, RecQ helicase-like
NCBI Official Symbol
WRN
NCBI Official Synonym Symbols
RECQ3; RECQL2; RECQL3
NCBI Protein Information
Werner syndrome ATP-dependent helicase; DNA helicase, RecQ-like type 3; exonuclease WRN; recQ protein-like 2
UniProt Protein Name
Werner syndrome ATP-dependent helicase
UniProt Gene Name
WRN
UniProt Synonym Gene Names
RECQ3; RECQL2; RecQ3
UniProt Entry Name
WRN_HUMAN

Uniprot Description

WRN: Multifunctional enzyme that has both magnesium and ATP- dependent DNA-helicase activity and 3'->5' exonuclease activity towards double-stranded DNA with a 5'-overhang. Has no nuclease activity towards single-stranded DNA or blunt-ended double- stranded DNA. Binds preferentially to DNA substrates containing alternate secondary structures, such as replication forks and Holliday junctions. May play an important role in the dissociation of joint DNA molecules that can arise as products of homologous recombination, at stalled replication forks or during DNA repair. Alleviates stalling of DNA polymerases at the site of DNA lesions. Important for genomic integrity. Plays a role in the formation of DNA replication focal centers; stably associates with foci elements generating binding sites for RP-A. Monomer, and homooligomer. May exist as homodimer, homotrimer, homotetramer and/or homohexamer. Homotetramer, or homohexamer, when bound to DNA. Interacts via its N-terminal domain with WRNIP1. Interacts with EXO1, PCNA and SUPV3L1. Belongs to the helicase family. RecQ subfamily.

Protein type: Nucleolus; EC 3.6.4.12; DNA repair, damage; Helicase; DNA-binding; Cell cycle regulation

Chromosomal Location of Human Ortholog: 8p12

Cellular Component: nucleoplasm; MutLalpha complex; centrosome; nucleolus

Molecular Function: G-quadruplex DNA binding; protein homodimerization activity; ATPase activity; magnesium ion binding; 3'-5' DNA helicase activity; bubble DNA binding; helicase activity; four-way junction helicase activity; ATP-dependent DNA helicase activity; Y-form DNA binding; protein binding; DNA helicase activity; DNA binding; ATP-dependent 3'-5' DNA helicase activity; manganese ion binding; exonuclease activity; protein complex binding; 3'-5' exonuclease activity; ATP binding

Biological Process: nucleolus to nucleoplasm transport; positive regulation of hydrolase activity; multicellular organismal aging; cell aging; cellular response to starvation; replicative cell aging; response to UV-C; DNA duplex unwinding; replication fork processing; DNA recombination; regulation of apoptosis; DNA synthesis during DNA repair; base-excision repair; double-strand break repair; regulation of growth rate; response to oxidative stress; DNA replication; response to DNA damage stimulus; DNA metabolic process; telomere maintenance; aging

Disease: Werner Syndrome

Similar Products

Product Notes

The WRN wrn (Catalog #AAA6173878) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's WRN can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the WRN wrn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WRN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.