Vascular non-inflammatory molecule 2 (VNN2) Recombinant Protein | VNN2 recombinant protein

Recombinant Human Vascular non-inflammatory molecule 2 (VNN2)

Cat. Num. AAA1008561

• Gene Names: VNN2; FOAP-4; GPI-80
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Vascular non-inflammatory molecule 2 (VNN2); Recombinant Human Vascular non-inflammatory molecule 2 (VNN2); VNN2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 23-493, Full length protein
• Sequence: QDSFIAAVYEHAVILPNKTETPVSQEDALNLMNENIDILETAIKQAAEQGARIIVTPEDALYGWKFTRETVFPYLEDIPDPQVNWIPCQDPHRFGHTPVQARLSCLAKDNSIYVLANLGDKKPCNSRDSTCPPNGYFQYNTNVVYNTEGKLVARYHKYHLYSEPQFNVPEKPELVTFNTAFGRFGIFTCFDIFFYDPGVTLVKDFHVDTILFPTAWMNVLPLLTAIEFHSAWAMGMGVNLLVANTHHVSLNMTGSGIYAPNGPKVYHYDMKTELGKLLLSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTELFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGAFTGLHGRRRREYWQVCTLLKCKTTNLTTCGRPVETASTRFEMFSLSGTFGTEYVFPEVLLTEIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLFGRWYTKDSLYSSC
• Sequence Length: 471

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for VNN2 recombinant protein

This gene product is a member of the Vanin family of proteins which share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to participate in hematopoietic cell trafficking. No biotinidase activity has been demonstrated for any of the vanin proteins, however, they possess pantetheinase activity, which may play a role in oxidative-stress response. The encoded protein is a GPI-anchored cell surface molecule that plays a role in transendothelial migration of neutrophils. This gene lies in close proximity to, and in same transcriptional orientation as two other vanin genes on chromosome 6q23-q24. Two transcript variants encoding different isoforms have been described for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 334278906
• NCBI GeneID: 8875
• NCBI Accession #: NP_001229279.1
• NCBI GenBank Nucleotide #: NM_001242350.2
• UniProt Accession #: O95498; Q2XUN1; Q9UJF3; A0AUZ3; A6NDY1; A8K4E3; A8K7W0; B2DFZ0; B2DFZ1; B2DFZ2; B2DFZ3; F6XL73
• Molecular Weight: 52,844 Da
• NCBI Official Full Name: vascular non-inflammatory molecule 2 isoform 3
• NCBI Official Synonym Full Names: vanin 2
• NCBI Official Symbol: VNN2
• NCBI Official Synonym Symbols: FOAP-4; GPI-80
• NCBI Protein Information: vascular non-inflammatory molecule 2
• UniProt Protein Name: Vascular non-inflammatory molecule 2
• Protein Family: Vascular non-inflammatory molecule
• UniProt Gene Name: VNN2
• UniProt Synonym Gene Names: Vanin-2

NCBI Description

This gene product is a member of the Vanin family of proteins that share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to participate in hematopoietic cell trafficking. No biotinidase activity has been demonstrated for any of the vanin proteins, however, they possess pantetheinase activity, which may play a role in oxidative-stress response. The encoded protein is a GPI-anchored cell surface molecule that plays a role in transendothelial migration of neutrophils. This gene lies in close proximity to, and in same transcriptional orientation as two other vanin genes on chromosome 6q23-q24. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, May 2011]

Uniprot Description

Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine. Involved in the thymus homing of bone marrow cells. May regulate beta-2 integrin-mediated cell adhesion, migration and motility of neutrophil.