Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mannonate dehydratase (uxuA) Recombinant Protein | Mmwyl1_2778 recombinant protein

Recombinant Marinomonas sp. Mannonate dehydratase (uxuA)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Mannonate dehydratase (uxuA); Recombinant Marinomonas sp. Mannonate dehydratase (uxuA); Mmwyl1_2778 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-391aa; full length protein
Sequence
MEHTWRWFGPNDETTLTDIRQTGATGVVTALHEIPNGEVWPVEAIKARKAMIEAHTLRWS VVESVPVHEDIKKRTGNYQEYIQNYKQTLLNLAECGIDTVCYNFMPVLDWTRTDLDYELP DGSRALRFDQTAFAAFELYILERKGAESEYSDEEKAQAKIFLENLKAEDKDRLVANIIAG LPGSEESYTIEQFREKLDEYAGIDKDKLREHLKLFLEEIVPAAEQGGLRLAIHPDDPPRP ILGLPRVVSVKDDIEWLLGAVPSPVNGITLCTGSYGVRADNDLVDMVQRFGSNIFFTHLR STKREEVAGSFHEASHLGGDVDMVGVVRALLVEEKKRNDNNAPSLIPMRPDHGHQILNDL EKNSKPGYSKLGRMKGLAEVRGLELGLKSTL
Sequence Length
391
Species
Marinomonas sp. (strain MWYL1)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for Mmwyl1_2778 recombinant protein
uxuA

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,006 Da
NCBI Official Full Name
mannonate dehydratase
NCBI Official Symbol
Mmwyl1_2778
NCBI Protein Information
mannonate dehydratase
UniProt Protein Name
Mannonate dehydratase
UniProt Gene Name
uxuA
UniProt Entry Name
UXUA_MARMS

Uniprot Description

Catalytic activity: D-mannonate = 2-dehydro-3-deoxy-D-gluconate + H2O. HAMAP-Rule MF_00106

Pathway: Carbohydrate metabolism; pentose and glucuronate interconversion. HAMAP-Rule MF_00106

Sequence similarities: Belongs to the mannonate dehydratase family.

Similar Products

Product Notes

The Mmwyl1_2778 uxua (Catalog #AAA1069867) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-391aa; full length protein. The amino acid sequence is listed below: MEHTWRWFGP NDETTLTDIR QTGATGVVTA LHEIPNGEVW PVEAIKARKA MIEAHTLRWS VVESVPVHED IKKRTGNYQE YIQNYKQTLL NLAECGIDTV CYNFMPVLDW TRTDLDYELP DGSRALRFDQ TAFAAFELYI LERKGAESEY SDEEKAQAKI FLENLKAEDK DRLVANIIAG LPGSEESYTI EQFREKLDEY AGIDKDKLRE HLKLFLEEIV PAAEQGGLRL AIHPDDPPRP ILGLPRVVSV KDDIEWLLGA VPSPVNGITL CTGSYGVRAD NDLVDMVQRF GSNIFFTHLR STKREEVAGS FHEASHLGGD VDMVGVVRAL LVEEKKRNDN NAPSLIPMRP DHGHQILNDL EKNSKPGYSK LGRMKGLAEV RGLELGLKST L. It is sometimes possible for the material contained within the vial of "Mannonate dehydratase (uxuA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.