Mouse anti-Human CHST4 Monoclonal Antibody | anti-CHST4 antibody

CHST4 (Carbohydrate Sulfotransferase 4, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3, GST-3, High Endothelial Cells N-acetylglucosamine 6-O-sulfotransferase, HEC-GlcNAc6ST, L-selectin Ligand Sulfotransferase, LSST, N-acetylgluc

Cat. Num. AAA6130596

• Gene Names: CHST4; GST3; LSST; GlcNAc6ST2; HECGLCNAC6ST
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CHST4; Monoclonal Antibody; CHST4 (Carbohydrate Sulfotransferase 4; Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3; GST-3; High Endothelial Cells N-acetylglucosamine 6-O-sulfotransferase; HEC-GlcNAc6ST; L-selectin Ligand Sulfotransferase; LSST; N-acetylgluc; anti-CHST4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4D7
• Specificity: Recognizes human CHST4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 2145

• Applicable Applications for anti-CHST4 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa221-320 from CHST4 (NP_005760) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAF
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CHST4 is ~3ng/ml as a capture antibody.)

Related Product Information for anti-CHST4 antibody

Catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues within mucin-associated glycans that ultimately serve as L-selectin ligands. L-selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation. Participates in biosynthesis of L-selectin ligand sialyl 6-sulfo Lewis X on L-selectin counter receptors CD43, GlyCAM-1 and MAdCAM-1. Also involved in biosynthesis of L-selectin ligand recognized by MECA-79 antibody. Plays a central role in lymphocyte trafficking during chronic inflammation. Has a catalytic preference for core 2-branched mucin-type O-glycans. Can use GlcNAcbeta1-6[Galbeta1-3]GalNAc-pNP (core 2), GlcNAcbeta1-6ManOMe and GlcNAcbeta1-2Man oligosaccharide structures as acceptors. Has also activity toward core 3 of GlcNAcbeta1-3GalNAc-pNP. Its substrate specificity may be influenced by its subcellular location.

Product Categories/Family for anti-CHST4 antibody

Antibodies; Enzymes; Sulfotransferase

NCBI and Uniprot Product Information

• NCBI GI #: 262205902
• NCBI GeneID: 10164
• NCBI Accession #: NM_005769.2
• NCBI GenBank Nucleotide #: NM_005769
• UniProt Accession #: Q8NCG5
• NCBI Official Full Name: Homo sapiens carbohydrate sulfotransferase 4 (CHST4), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: carbohydrate sulfotransferase 4
• NCBI Official Symbol: CHST4
• NCBI Official Synonym Symbols: GST3; LSST; GlcNAc6ST2; HECGLCNAC6ST
• NCBI Protein Information: carbohydrate sulfotransferase 4
• UniProt Protein Name: Carbohydrate sulfotransferase 4
• Protein Family: Carbohydrate sulfotransferase
• UniProt Gene Name: CHST4
• UniProt Synonym Gene Names: GST-3; HEC-GlcNAc6ST; LSST; GlcNAc6ST-2; Gn6st-2

NCBI Description

This gene encodes an N-acetylglucosamine 6-O sulfotransferase. The encoded enzyme transfers sulfate from 3'phosphoadenosine 5'phospho-sulfate to the 6-hydroxyl group of N-acetylglucosamine on glycoproteins. This protein is localized to the Golgi and is involved in the modification of glycan structures on ligands of the lymphocyte homing receptor L-selectin. Alternate splicing in the 5' UTR results in multiple transcript variants that encode the same protein. [provided by RefSeq, Oct 2009]

Uniprot Description

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues within mucin-associated glycans that ultimately serve as SELL ligands. SELL ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation. Participates in biosynthesis of the SELL ligand sialyl 6-sulfo Lewis X on receptors SPN/CD43, GLYCAM1 and MADCAM1. Also involved in biosynthesis of SELL ligand recognized by MECA-79 antibody. Plays a central role in lymphocyte trafficking during chronic inflammation. Has a catalytic preference for core 2-branched mucin-type O-glycans. Can use GlcNAcbeta1-6[Galbeta1-3]GalNAc-pNP (core 2), GlcNAcbeta1-6ManOMe and GlcNAcbeta1-2Man oligosaccharide structures as acceptors. Has also activity toward core 3 of GlcNAcbeta1-3GalNAc-pNP. Its substrate specificity may be influenced by its subcellular location.