Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

UDP-glucuronosyltransferase 1-2 (Ugt1) Recombinant Protein | Ugt1 recombinant protein

Recombinant Mouse UDP-glucuronosyltransferase 1-2 (Ugt1)

Gene Names
Ugt1a2; Ugt1; UDPGT 1-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UDP-glucuronosyltransferase 1-2 (Ugt1); Recombinant Mouse UDP-glucuronosyltransferase 1-2 (Ugt1); Ugt1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
28-533aa; full length protein
Sequence
AKVLVLPMEGSQWLSMRDVVRELHARGHQTVVLASEVTVHIKGEDFFTLKTYAFPYTKEE YQQEILSDIEKTFKTQHFVKAFFETTASIRNFFDLYSNSCIALLHNKMLIQQLNSSFFDV ILTDPIFPCGAVLAKYLQIPAVFILRSLSCGIEYEATQCPNPSSYIPNLLTRLSDHMDFL QRVQNMLYYLVLKYICRLSITPYESLASELLQREVSLVEVLSHASVWLFRGDFVLDYPRP IMPNMVFIGGINCVTKKPLSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALG RIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVP MVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLH KDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVF KCCAYGCRKCFGGKGRVKKSHKSKTH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ugt1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,285 Da
NCBI Official Full Name
UDP-glucuronosyltransferase 1-2
NCBI Official Synonym Full Names
UDP glucuronosyltransferase 1 family, polypeptide A2
NCBI Official Symbol
Ugt1a2
NCBI Official Synonym Symbols
Ugt1; UDPGT 1-2
NCBI Protein Information
UDP-glucuronosyltransferase 1-2
UniProt Protein Name
UDP-glucuronosyltransferase 1-2
UniProt Gene Name
Ugt1a2
UniProt Synonym Gene Names
Ugt1; UDPGT 1-2; UGT1*2; UGT1-02; UGT1.2; UGT1A2
UniProt Entry Name
UD12_MOUSE

Uniprot Description

UGT1A3: UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. Belongs to the UDP-glycosyltransferase family. 1 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - androgen and estrogen; EC 2.4.1.17; Carbohydrate Metabolism - starch and sucrose; Membrane protein, integral; Xenobiotic Metabolism - metabolism by cytochrome P450; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Transferase; Xenobiotic Metabolism - drug metabolism - other enzymes; Cofactor and Vitamin Metabolism - retinol; Cofactor and Vitamin Metabolism - porphyrin and chlorophyll; Carbohydrate Metabolism - ascorbate and aldarate; Carbohydrate Metabolism - pentose and glucuronate interconversions

Cellular Component: endoplasmic reticulum; integral to membrane; intracellular membrane-bound organelle; membrane

Molecular Function: enzyme binding; glucuronosyltransferase activity; protein heterodimerization activity; protein homodimerization activity; retinoic acid binding; transferase activity; transferase activity, transferring glycosyl groups; transferase activity, transferring hexosyl groups

Biological Process: flavonoid biosynthetic process; metabolic process

Research Articles on Ugt1

Similar Products

Product Notes

The Ugt1 ugt1a2 (Catalog #AAA7032797) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-533aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ugt1 ugt1a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AKVLVLPMEG SQWLSMRDVV RELHARGHQT VVLASEVTVH IKGEDFFTLK TYAFPYTKEE YQQEILSDIE KTFKTQHFVK AFFETTASIR NFFDLYSNSC IALLHNKMLI QQLNSSFFDV ILTDPIFPCG AVLAKYLQIP AVFILRSLSC GIEYEATQCP NPSSYIPNLL TRLSDHMDFL QRVQNMLYYL VLKYICRLSI TPYESLASEL LQREVSLVEV LSHASVWLFR GDFVLDYPRP IMPNMVFIGG INCVTKKPLS QEFEAYVNAS GEHGIVVFSL GSMVSEIPEK KAMEIAEALG RIPQTVLWRY TGTRPSNLAK NTILVKWLPQ NDLLGHPKTR AFITHSGSHG IYEGICNGVP MVMMPLFGDQ MDNAKRMETR GAGVTLNVLE MTADDLENAL KTVINNKSYK ENIMRLSSLH KDRPIEPLDL AVFWVEYVMR HKGAPHLRPA AHDLTWYQYH SLDVIGFLLA IVLTVVFIVF KCCAYGCRKC FGGKGRVKKS HKSKTH. It is sometimes possible for the material contained within the vial of "UDP-glucuronosyltransferase 1-2 (Ugt1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.