Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DUSP4 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole CellDUSP4 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells)

Rabbit DUSP4 Polyclonal Antibody | anti-DUSP4 antibody

DUSP4 antibody - C-terminal region

Gene Names
DUSP4; TYP; HVH2; MKP2; MKP-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DUSP4; Polyclonal Antibody; DUSP4 antibody - C-terminal region; anti-DUSP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GQLLQFESQVLATSCAAEAASPSGPLRERGKTPATPTSQFVFSFPVSVGV
Sequence Length
394
Applicable Applications for anti-DUSP4 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 85%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 85%; Rat: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DUSP4 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole CellDUSP4 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells)

Western Blot (WB) (WB Suggested Anti-DUSP4 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole CellDUSP4 is strongly supported by BioGPS gene expression data to be expressed in Human COLO205 cells)
Related Product Information for anti-DUSP4 antibody
This is a rabbit polyclonal antibody against DUSP4. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, ERK2 and JNK, is expressed in a variety of tissues, and is localized in the nucleus. Two alternatively spliced transcript variants, encoding distinct isoforms, have been observed for this gene. In addition, multiple polyadenylation sites have been reported.
Product Categories/Family for anti-DUSP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
dual specificity protein phosphatase 4 isoform 1
NCBI Official Synonym Full Names
dual specificity phosphatase 4
NCBI Official Symbol
DUSP4
NCBI Official Synonym Symbols
TYP; HVH2; MKP2; MKP-2
NCBI Protein Information
dual specificity protein phosphatase 4
UniProt Protein Name
Dual specificity protein phosphatase 4
UniProt Gene Name
DUSP4
UniProt Synonym Gene Names
MKP2; VH2; MAP kinase phosphatase 2; MKP-2
UniProt Entry Name
DUS4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, ERK2 and JNK, is expressed in a variety of tissues, and is localized in the nucleus. Two alternatively spliced transcript variants, encoding distinct isoforms, have been observed for this gene. In addition, multiple polyadenylation sites have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

MKP-2: a non-receptor, dual-specificity phosphoprotein phosphatase (DUSP). Different members of the DUSP family show distinct substrate specificities for MAPKs, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. DUSP4 inactivates ERK1, ERK2 and JNK, is expressed in a variety of tissues, and is localized in the nucleus. Induced by hepatocyte growth factor (HGF) and vascular endothelial cell growth factor (VEGF) in human endothelial cells. Two alternatively spliced isoforms have been described. In addition, multiple polyadenylation sites have been reported. Contains 1 rhodanese domain.

Protein type: Protein phosphatase, dual-specificity; EC 3.1.3.48; EC 3.1.3.16

Chromosomal Location of Human Ortholog: 8p12-p11

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein tyrosine/threonine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity; protein tyrosine phosphatase activity; MAP kinase tyrosine/serine/threonine phosphatase activity

Biological Process: nerve growth factor receptor signaling pathway; MyD88-independent toll-like receptor signaling pathway; stress-activated MAPK cascade; MAPKKK cascade; toll-like receptor 3 signaling pathway; protein amino acid dephosphorylation; toll-like receptor 2 signaling pathway; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; endoderm formation; toll-like receptor signaling pathway; innate immune response; toll-like receptor 9 signaling pathway; toll-like receptor 4 signaling pathway; inactivation of MAPK activity

Research Articles on DUSP4

Similar Products

Product Notes

The DUSP4 dusp4 (Catalog #AAA3216289) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DUSP4 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DUSP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DUSP4 dusp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQLLQFESQV LATSCAAEAA SPSGPLRERG KTPATPTSQF VFSFPVSVGV. It is sometimes possible for the material contained within the vial of "DUSP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.