Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Ubiquitin-Conjugating Enzyme E2L 3 Recombinant Protein | UBE2L3 recombinant protein

Recombinant Human Ubiquitin-Conjugating Enzyme E2L 3, His Tag

Gene Names
UBE2L3; E2-F1; L-UBC; UBCH7; UbcM4
Purity
Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Ubiquitin-Conjugating Enzyme E2L 3; Recombinant Human Ubiquitin-Conjugating Enzyme E2L 3; His Tag; UBE2L3 Human His; Ubiquitin-Conjugating Enzyme E2L 3 Human Recombinant; Ubiquitin-conjugating enzyme E2 L3; EC 6.3.2.19; Ubiquitin-protein ligase L3; Ubiquitin carrier protein L3; UbcH7; E2-F1; L-UBC; UbcM4; UBE2L3 His; UBE2L3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
Lyophilized from a 0.2um filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5.
Sterile Filtered white lyophilized powder.
Sequence
MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
Sequence Length
212
Solubility
It is recommended to reconstitute the lyophilized UBE2L3 in sterile water not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Preparation and Storage
Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution UBE2L3 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for UBE2L3 recombinant protein
Description: Ubiquitin-Conjugating Enzyme E2L 3 Human Recombinant produced in E Coli is an 18.9 kDa protein containing 162 amino acids.The UBE2L3 protein contains 6xHis tag and is purified by proprietary chromatographic techniques.

Introduction: Human Ubquitin Conjugating Enzyme 7 (UbcH7) is a class I enzyme which functions in the stress response and the control of transcription factors. The enzyme is ubiquitously expressed with high levels of expression seen in adult muscle. UbcH7 mediates the selective degradation of short-lived and abnormal proteins and is highly homologous to UbcH5. It has been demonstrated to participate in the ubiquitinylation of p53, c-Fos and NF-?B. UbcH7 is one of two E2s (UbcH5 being the other) with which HECT domain proteins interact with UbcH7 being able to efficiently substitute for UbcH5 in E6-AP-dependent ubiquitinylation.
Product Categories/Family for UBE2L3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,004 Da
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 L3 isoform 4
NCBI Official Synonym Full Names
ubiquitin-conjugating enzyme E2L 3
NCBI Official Symbol
UBE2L3
NCBI Official Synonym Symbols
E2-F1; L-UBC; UBCH7; UbcM4
NCBI Protein Information
ubiquitin-conjugating enzyme E2 L3; ubiquitin carrier protein L3; ubiquitin-conjugating enzyme E2-F1; ubiquitin-conjugating enzyme UBCH7; ubiquitin-protein ligase L3
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 L3
UniProt Gene Name
UBE2L3
UniProt Synonym Gene Names
UBCE7; UBCH7
UniProt Entry Name
UB2L3_HUMAN

NCBI Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro. Several alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2009]

Uniprot Description

UBE2L3: Ubiquitin-conjugating enzyme E2 that specifically acts with HECT-type and RBR family E3 ubiquitin-protein ligases. Does not function with most RING-containing E3 ubiquitin-protein ligases because it lacks intrinsic E3-independent reactivity with lysine: in contrast, it has activity with the RBR family E3 enzymes, such as PARK2 and ARIH1, that function like function like RING-HECT hybrids. Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-linked polyubiquitination. Involved in the selective degradation of short-lived and abnormal proteins. Down- regulated during the S-phase it is involved in progression through the cell cycle. Regulates nuclear hormone receptors transcriptional activity. May play a role in myelopoiesis. Interacts with PARK2; involved in ubiquitination and degradation of misfolded proteins. Interacts with UBE3A; used by the papilloma virus HPV-16 E6 protein to ubiquitinate p53/TP53. Interacts with CCNB1IP1, CBL, ZAP70, RNF19A, RNF19B and RNF144B. Interacts with ARIH1. Interacts with ARIH2 (via RING-type 1). Interacts with NCOA1; they functionally interact to regulate progesterone receptor transcriptional activity. May interact with NR3C1. Ubiquitous, with highest expression in testis. Belongs to the ubiquitin-conjugating enzyme family.

Protein type: Nuclear receptor co-regulator; Ligase; Ubiquitin ligase; EC 6.3.2.19; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: cytoplasm; nucleus; ubiquitin ligase complex

Molecular Function: protein binding; enzyme binding; ubiquitin protein ligase binding; transcription coactivator activity; ubiquitin-protein ligase activity; ATP binding; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; cell proliferation; protein polyubiquitination; transcription, DNA-dependent; regulation of transcription, DNA-dependent; positive regulation of protein ubiquitination; positive regulation of ubiquitin-protein ligase activity; protein modification process; protein ubiquitination

Research Articles on UBE2L3

Similar Products

Product Notes

The UBE2L3 ube2l3 (Catalog #AAA142485) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MHHHHHHAMA ASRRLMKELE EIRKCGMKNF RNIQVDEANL LTWQGLIVPD NPPYDKGAFR IEINFPAEYP FKPPKITFKT KIYHPNIDEK GQVCLPVISA ENWKPATKTD QVIQSLIALV NDPQPEHPLR ADLAEEYSKD RKKFCKNAEE FTKKYGEKRP VD. It is sometimes possible for the material contained within the vial of "Ubiquitin-Conjugating Enzyme E2L 3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.