Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TYRO protein tyrosine kinase-binding protein Recombinant Protein | Tyrobp recombinant protein

TYRO protein tyrosine kinase-binding protein

Gene Names
Tyrobp; Ly83; DAP12; KARAP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
TYRO protein tyrosine kinase-binding protein; Tyrobp recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
22-114aa; full length protein
Sequence
LSPVQAQSDTFPRCDCSSVSPGVLAGIVLGDLVLTLLIALAVYSLGRLVSRGQGTAEGTRKQHIAETESPYQELQGQRPEVYSDLNTQRQYYR
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Tyrobp recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Tyrobp recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,367 Da
NCBI Official Full Name
TYRO protein tyrosine kinase-binding protein
NCBI Official Synonym Full Names
TYRO protein tyrosine kinase binding protein
NCBI Official Symbol
Tyrobp
NCBI Official Synonym Symbols
Ly83; DAP12; KARAP
NCBI Protein Information
TYRO protein tyrosine kinase-binding protein
UniProt Protein Name
TYRO protein tyrosine kinase-binding protein
UniProt Gene Name
Tyrobp
UniProt Synonym Gene Names
Dap12; Karap; KAR-associated protein
UniProt Entry Name
TYOBP_MOUSE

Uniprot Description

TYROBP: Non-covalently associates with activating receptors of the CD300 family. Cross-linking of CD300-TYROBP complexes results in cellular activation. Involved for instance in neutrophil activation mediated by integrin. Defects in TYROBP are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL); also called presenile dementia with bone cysts or Nasu-Hakola disease (NHD). PLOSL is a recessively inherited disease characterized by a combination of psychotic symptoms rapidly progressing to presenile dementia and bone cysts restricted to wrists and ankles. PLOSL has a global distribution, although most of the patients have been diagnosed in Finland and Japan, with an estimated population prevalence of 2x10(-6) in the Finns. Belongs to the TYROBP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cell surface

Cellular Component: cell surface

Molecular Function: identical protein binding; protein binding; receptor binding

Biological Process: integrin-mediated signaling pathway; macrophage activation during immune response; neutrophil activation during immune response

Research Articles on Tyrobp

Similar Products

Product Notes

The Tyrobp tyrobp (Catalog #AAA7043528) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-114aa; full length protein. The amino acid sequence is listed below: LSPVQAQSDT FPRCDCSSVS PGVLAGIVLG DLVLTLLIAL AVYSLGRLVS RGQGTAEGTR KQHIAETESP YQELQGQRPE VYSDLNTQRQ YYR. It is sometimes possible for the material contained within the vial of "TYRO protein tyrosine kinase-binding protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.