Activating signal cointegrator 1 (Trip4) Recombinant Protein | Trip4 recombinant protein
Recombinant Mouse Activating signal cointegrator 1 (Trip4)
Gene Names
Trip4; Asc1; ASC-1; BB191711; 4930558E03Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Activating signal cointegrator 1 (Trip4); Recombinant Mouse Activating signal cointegrator 1 (Trip4); Trip4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-581, Full length protein
Sequence
AVAGAAYREPLVHWCTQQLQKTFALDVSEEIIQYVLSIENAEEIREYVTDLLQGNEGKKGQFIEDLITKWQKNDQEFISDSFQQCLRKDEILDGQRSVDQLKRSRRKGRNKQEVPAFPEPDVAVEVKTPLDLAKAQESNNSVKKKTRFVNLYTREGQDKLAVLLPGRHPCDCLGQKHKLINNCLVCGRIVCEQEGSGPCLFCGSLVCTNEEQDILQRDSNKSQKLLKKLMSGAETSGKVDVSTKDLLPHQESRMKSGLEKAIKHKEKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSKVEREMLQKREEELRELRHASRLSKKVTIDFAGRKILEDENPLAEYHSRLDETIQAIASGTLNQSLVTLDRSCEEPLGVLVNPNMYQASPQWVDNTGSTPQKKTSLSAGPRLEPSLHQHQLRIQDQEFQEGFDGGWCLSMHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATGKRPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFQEQFPDISQESDSSFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKAV
Sequence Length
580
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
61,533 Da
NCBI Official Full Name
activating signal cointegrator 1 isoform 2
NCBI Official Synonym Full Names
thyroid hormone receptor interactor 4
NCBI Official Symbol
Trip4
NCBI Official Synonym Symbols
Asc1; ASC-1; BB191711; 4930558E03Rik
NCBI Protein Information
activating signal cointegrator 1
UniProt Protein Name
Activating signal cointegrator 1
Protein Family
UniProt Gene Name
Trip4
UniProt Synonym Gene Names
TR-interacting protein 4Curated; TRIP-4Curated
Uniprot Description
Transcription coactivator which associates with nuclear receptors, transcriptional coactivators including EP300, CREBBP and NCOA1, and basal transcription factors like TBP and TFIIA to facilitate nuclear receptors-mediated transcription. May thereby play an important role in establishing distinct coactivator complexes under different cellular conditions. Plays a role in thyroid hormone receptor and estrogen receptor transactivation (). Also involved in androgen receptor transactivation (PubMed:12077347). Plays a pivotal role in the transactivation of NF-kappa-B, SRF and AP1. Acts as a mediator of transrepression between nuclear receptor and either AP1 or NF-kappa-B. May play a role in the development of neuromuscular junction (). May play a role in late myogenic differentiation (PubMed:27008887).
Research Articles on Trip4
Similar Products
Product Notes
The Trip4 trip4 (Catalog #AAA1482913) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-581, Full length protein. The amino acid sequence is listed below: AVAGAAYREP LVHWCTQQLQ KTFALDVSEE IIQYVLSIEN AEEIREYVTD LLQGNEGKKG QFIEDLITKW QKNDQEFISD SFQQCLRKDE ILDGQRSVDQ LKRSRRKGRN KQEVPAFPEP DVAVEVKTPL DLAKAQESNN SVKKKTRFVN LYTREGQDKL AVLLPGRHPC DCLGQKHKLI NNCLVCGRIV CEQEGSGPCL FCGSLVCTNE EQDILQRDSN KSQKLLKKLM SGAETSGKVD VSTKDLLPHQ ESRMKSGLEK AIKHKEKLLE FDRTSIRRTQ VIDDESDYFA SDSNQWLSKV EREMLQKREE ELRELRHASR LSKKVTIDFA GRKILEDENP LAEYHSRLDE TIQAIASGTL NQSLVTLDRS CEEPLGVLVN PNMYQASPQW VDNTGSTPQK KTSLSAGPRL EPSLHQHQLR IQDQEFQEGF DGGWCLSMHQ PWASLLVRGI KRVEGRSWYT PHRGRLWIAA TGKRPSPQEV SELQATYRLL RGKDVEFPND YPSGCLLGCV DLIDCLSQKQ FQEQFPDISQ ESDSSFVFIC KNPQEMVVKF PIKGNPKIWK LDSKIHQGAK KGLMKQNKAV. It is sometimes possible for the material contained within the vial of "Activating signal cointegrator 1 (Trip4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
