TP53-regulated inhibitor of apoptosis 1-A (triap1-a) Recombinant Protein | triap1-a recombinant protein

Recombinant Xenopus laevis TP53-regulated inhibitor of apoptosis 1-A (triap1-a)

Cat. Num. AAA1404066

• Gene Names: triap1.S; P53csv; triap1; triap1a; p53csv-A; triap1-a; triap1-b
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: TP53-regulated inhibitor of apoptosis 1-A (triap1-a); Recombinant Xenopus laevis TP53-regulated inhibitor of apoptosis 1-A (triap1-a); triap1-a recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-78, Full length protein
• Sequence: MNSVGEECTDMKRDYDQCFNRWFAEKFLKGAGSGDPCTELFRRYRECVQKAIKDKDIPVDGVDFMGPSKSKTESDGSS
• Sequence Length: 78

• Species: Xenopus laevis (African clawed frog)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 284447289
• NCBI GeneID: 432296
• NCBI Accession #: NP_001165176.1
• NCBI GenBank Nucleotide #: NM_001171705.1
• UniProt Accession #: Q6INR6
• Molecular Weight: 8,840 Da
• NCBI Official Full Name: TP53-regulated inhibitor of apoptosis 1-A
• NCBI Official Synonym Full Names: TP53 regulated inhibitor of apoptosis 1 S homeolog
• NCBI Official Symbol: triap1.S
• NCBI Official Synonym Symbols: P53csv; triap1; triap1a; p53csv-A; triap1-a; triap1-b
• NCBI Protein Information: TP53-regulated inhibitor of apoptosis 1-A
• UniProt Protein Name: TP53-regulated inhibitor of apoptosis 1-A
• Protein Family: TP53-regulated inhibitor of apoptosis
• UniProt Gene Name: triap1-a
• UniProt Synonym Gene Names: p53csv-A

Uniprot Description

Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. The triap1:prelid1 complex probably functions as a phosphatidic acid (PA) transporter across the mitochondrion intermembrane space to provide PA for cardiolipin CL synthesis in the inner membrane. Likewise, the triap1:prelid3a complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis (). Required for pronephros development; probably involved at an early stage in the formation of pronephric components derived from the somatic layer ().