Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

TP53-regulated inhibitor of apoptosis 1 (TRIAP1) Recombinant Protein | TRIAP1 recombinant protein

Recombinant Human TP53-regulated inhibitor of apoptosis 1 (TRIAP1)

Gene Names
TRIAP1; WF-1; MDM35; P53CSV; HSPC132
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
TP53-regulated inhibitor of apoptosis 1 (TRIAP1); Recombinant Human TP53-regulated inhibitor of apoptosis 1 (TRIAP1); TP53-regulated inhibitor of apoptosis 1; Protein 15E1.1; WF-1; p53-inducible cell-survival factor; p53CSV; TRIAP1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-76aa; Full Length
Sequence
MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS
Sequence Length
76
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for TRIAP1 recombinant protein
Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis
Product Categories/Family for TRIAP1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.8 kDa
NCBI Official Full Name
TP53-regulated inhibitor of apoptosis 1
NCBI Official Synonym Full Names
TP53 regulated inhibitor of apoptosis 1
NCBI Official Symbol
TRIAP1
NCBI Official Synonym Symbols
WF-1; MDM35; P53CSV; HSPC132
NCBI Protein Information
TP53-regulated inhibitor of apoptosis 1; protein 15E1.1; p53-inducible cell-survival factor; mitochondrial distribution and morphology 35 homolog
UniProt Protein Name
TP53-regulated inhibitor of apoptosis 1
UniProt Gene Name
TRIAP1
UniProt Synonym Gene Names
15E1.1; p53CSV
UniProt Entry Name
TRIA1_HUMAN

Uniprot Description

TRIAP1: Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis. Belongs to the TRIAP1/MDM35 family.

Protein type: Apoptosis; Inhibitor; Mitochondrial

Chromosomal Location of Human Ortholog: 12q24.31

Cellular Component: protein complex; mitochondrion; perinuclear region of cytoplasm; mitochondrial intermembrane space

Molecular Function: protein binding; p53 binding

Biological Process: DNA damage response, signal transduction by p53 class mediator; phospholipid transport; positive regulation of transcription from RNA polymerase II promoter; negative regulation of caspase activity; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; negative regulation of apoptosis

Research Articles on TRIAP1

Similar Products

Product Notes

The TRIAP1 triap1 (Catalog #AAA1026539) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-76aa; Full Length. The amino acid sequence is listed below: MNSVGEACTD MKREYDQCFN RWFAEKFLKG DSSGDPCTDL FKRYQQCVQK AIKEKEIPIE GLEFMGHGKE KPENSS. It is sometimes possible for the material contained within the vial of "TP53-regulated inhibitor of apoptosis 1 (TRIAP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.