Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human APRIL Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60 kDa.)

APRIL recombinant protein

Recombinant Human APRIL Protein

Gene Names
TNFSF13; APRIL; CD256; TALL2; ZTNF2; TALL-2; TNLG7B; TRDL-1; UNQ383/PRO715
Purity
>90% by SDS-PAGE.
Synonyms
APRIL; Recombinant Human APRIL Protein; Tumor necrosis factor ligand superfamily member 13; A proliferation-inducing ligand; TNFand APOL-related leukocyte expressed ligand 2; TALL-2; TNF-related death ligand 1; TRDL-1; CD256; TNFSF13; APRIL recombinant protein
Ordering
For Research Use Only!
Host
Mammalian
Purity/Purification
>90% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH7.4.
Sequence
KKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
Sequence Length
222
Species
Human
Endotoxin
< 1.0 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
DYKDDDDK, 6xHis tag at the N-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human APRIL Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60 kDa.)

SDS-Page (Recombinant Human APRIL Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 60 kDa.)
Related Product Information for APRIL recombinant protein
Description: Recombinant Human APRIL Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Lys112-Leu250) of human APRIL (Accession #O75888) fused with a DYKDDDDK, 6xHis tag at the N-terminus.

Background: This protein is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13.
Product Categories/Family for APRIL recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 13 isoform zeta
NCBI Official Synonym Full Names
TNF superfamily member 13
NCBI Official Symbol
TNFSF13
NCBI Official Synonym Symbols
APRIL; CD256; TALL2; ZTNF2; TALL-2; TNLG7B; TRDL-1; UNQ383/PRO715
NCBI Protein Information
tumor necrosis factor ligand superfamily member 13
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 13
UniProt Gene Name
TNFSF13
UniProt Synonym Gene Names
APRIL; TALL2; ZTNF2; APRIL; TALL-2; TRDL-1
UniProt Entry Name
TNF13_HUMAN

NCBI Description

The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13. [provided by RefSeq, Oct 2010]

Uniprot Description

TNFSF13: Cytokine that binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. May be implicated in the regulation of tumor cell growth. May be involved in monocyte/macrophage-mediated immunological processes. Belongs to the tumor necrosis factor family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: nucleoplasm; extracellular space; cytoplasm; cytosol; external side of plasma membrane

Molecular Function: cytokine activity; tumor necrosis factor receptor binding; receptor binding

Biological Process: immunoglobulin production in mucosal tissue; positive regulation of cell proliferation; positive regulation of germinal center formation; gene expression; signal transduction; positive regulation of isotype switching to IgA isotypes

Research Articles on APRIL

Similar Products

Product Notes

The APRIL tnfsf13 (Catalog #AAA9141934) is a Recombinant Protein produced from Mammalian and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: KKQHSVLHLV PINATSKDDS DVTEVMWQPA LRRGRGLQAQ GYGVRIQDAG VYLLYSQVLF QDVTFTMGQV VSREGQGRQE TLFRCIRSMP SHPDRAYNSC YSAGVFHLHQ GDILSVIIPR ARAKLNLSPH GTFLGFVKL. It is sometimes possible for the material contained within the vial of "APRIL, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.