Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Tumor necrosis factor receptor superfamily member 4 Recombinant Protein | Tnfrsf4 recombinant protein

Recombinant Mouse Tumor necrosis factor receptor superfamily member 4

Gene Names
Tnfrsf4; Ox40; ACT35; CD134; Ly-70; Txgp1; TXGP1L
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor necrosis factor receptor superfamily member 4; Recombinant Mouse Tumor necrosis factor receptor superfamily member 4; OX40 antigen; OX40L receptor; CD_antigen: CD134; Tnfrsf4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-211aa; Extracellular Domain
Sequence
VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
Sequence Length
272
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Tnfrsf4 recombinant protein
Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity).
References
"Cloning of mouse Ox40: a T cell activation marker that may mediate T-B cell interactions." Calderhead D.M., Buhlmann J.E., van den Eertwegh A.J., Claassen E., Noelle R.J., Fell H. J. Immunol. 151:5261-5271(1993)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37.3 kDa
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 4
NCBI Official Synonym Full Names
tumor necrosis factor receptor superfamily, member 4
NCBI Official Symbol
Tnfrsf4
NCBI Official Synonym Symbols
Ox40; ACT35; CD134; Ly-70; Txgp1; TXGP1L
NCBI Protein Information
tumor necrosis factor receptor superfamily member 4
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 4
UniProt Gene Name
Tnfrsf4
UniProt Synonym Gene Names
Ox40; Txgp1
UniProt Entry Name
TNR4_MOUSE

Uniprot Description

TNFRSF4: Receptor for TNFSF4/OX40L/GP34.

Protein type: Receptor, misc.; Apoptosis; Membrane protein, integral

Cellular Component: cell surface; external side of plasma membrane; integral to membrane; integral to plasma membrane; membrane; plasma membrane

Molecular Function: protein binding; tumor necrosis factor receptor activity

Biological Process: cellular defense response; immune response; inflammatory response; multicellular organismal development; negative regulation of cytokine secretion; negative regulation of transcription factor activity; negative regulation of transcription, DNA-dependent; positive regulation of B cell proliferation; positive regulation of immunoglobulin secretion; positive regulation of MAPKKK cascade; regulation of apoptosis; regulation of protein kinase activity; response to lipopolysaccharide; T cell proliferation

Research Articles on Tnfrsf4

Similar Products

Product Notes

The Tnfrsf4 tnfrsf4 (Catalog #AAA956211) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-211aa; Extracellular Domain. The amino acid sequence is listed below: VTARRLNCVK HTYPSGHKCC RECQPGHGMV SRCDHTRDTL CHPCETGFYN EAVNYDTCKQ CTQCNHRSGS ELKQNCTPTQ DTVCRCRPGT QPRQDSGYKL GVDCVPCPPG HFSPGNNQAC KPWTNCTLSG KQTRHPASDS LDAVCEDRSL LATLLWETQR PTFRPTTVQS TTVWPRTSEL PSPPTLVTPE GP. It is sometimes possible for the material contained within the vial of "Tumor necrosis factor receptor superfamily member 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.