Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Enteropeptidase (Tmprss15), partial Recombinant Protein | Tmprss15 recombinant protein

Recombinant Mouse Enteropeptidase (Tmprss15), partial

Gene Names
Tmprss15; Entk; Prss7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Enteropeptidase (Tmprss15); partial; Recombinant Mouse Enteropeptidase (Tmprss15); Enteropeptidase; EC=3.4.21.9; Enterokinase; Serine protease 7; Transmembrane protease serine 15Cleaved into the following 2 chains:; 1. Enteropeptidase non-catalytic heavy chain; 2. Enteropeptidase catalytic light chain; Tmprss15 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
830-1069. Partial
Sequence
IVGGSDAQAGAWPWVVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDQIVINPHYDRRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQIFIPGRTCSIAGWGYDKINAGSTVDVLKEADVPLISNEKCQQQLPEYNITESMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNHPGVYVRVSQFIEWIHSFLH
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for Tmprss15 recombinant protein
Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases
Product Categories/Family for Tmprss15 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43 kDa
NCBI Official Full Name
enteropeptidase isoform 1
NCBI Official Synonym Full Names
transmembrane protease, serine 15
NCBI Official Symbol
Tmprss15
NCBI Official Synonym Symbols
Entk; Prss7
NCBI Protein Information
enteropeptidase; enterokinase; protease, serine, 7 (enterokinase)
UniProt Protein Name
Enteropeptidase
Protein Family
UniProt Gene Name
Tmprss15
UniProt Synonym Gene Names
Entk; Prss7
UniProt Entry Name
ENTK_MOUSE

NCBI Description

This gene encodes an enzyme that proteolytically activates the pancreatic proenzyme trypsinogen, converting it into trypsin. The encoded protein is cleaved into two chains that form a heterodimer linked by a disulfide bond. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2013]

Uniprot Description

PRSS7: Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases. Defects in TMPRSS15 are a cause of enterokinase deficiency (ENTKD); a life-threatening intestinal malabsorption disorder characterized by diarrhea and failure to thrive. Belongs to the peptidase S1 family.

Protein type: EC 3.4.21.9; Protease; Membrane protein, integral

Cellular Component: membrane; integral to membrane

Molecular Function: peptidase activity; hydrolase activity; serine-type peptidase activity; serine-type endopeptidase activity; catalytic activity; scavenger receptor activity

Biological Process: proteolysis

Research Articles on Tmprss15

Similar Products

Product Notes

The Tmprss15 tmprss15 (Catalog #AAA1103019) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 830-1069. Partial. The amino acid sequence is listed below: IVGGSDAQAG AWPWVVALYH RDRSTDRLLC GASLVSSDWL VSAAHCVYRR NLDPTRWTAV LGLHMQSNLT SPQVVRRVVD QIVINPHYDR RRKVNDIAMM HLEFKVNYTD YIQPICLPEE NQIFIPGRTC SIAGWGYDKI NAGSTVDVLK EADVPLISNE KCQQQLPEYN ITESMICAGY EEGGIDSCQG DSGGPLMCQE NNRWFLVGVT SFGVQCALPN HPGVYVRVSQ FIEWIHSFLH . It is sometimes possible for the material contained within the vial of "Enteropeptidase (Tmprss15), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.