SDS-PAGE
Metalloproteinase inhibitor 1 Recombinant Protein | Timp1 recombinant protein
Recombinant Rat Metalloproteinase inhibitor 1
Gene Names
Timp1; Timp; TIMP-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Metalloproteinase inhibitor 1; Recombinant Rat Metalloproteinase inhibitor 1; Tissue inhibitor of metalloproteinases 1; TIMP-1; Timp1 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
24-217aa; Full Length
Sequence
CSCAPTHPQTAFCNSDLVIRAKFMGSPEIIETTLYQRYEIKMTKMLKGFDAVGNATGFRFAYTPAMESLCGYVHKSQNRSEEFLIAGRLRNGNLHITACSFLVPWHNLSPAQQKAFVKTYSAGCGVCTVFPCSAIPCKLESDSHCLWTDQILMGSEKGYQSDHFACLPRNPDLCTWQYLGVSMTRSLPLAKAEA
Sequence Length
217
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Timp1 recombinant protein
Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Also stimulates steroidogenesis by Leydig and ovarian granuloma cells; procathepsin L is required for maximal activity.
References
Cloning of the cDNA encoding rat tissue inhibitor of metalloproteinase 1 (TIMP-1)
, amino acid comparison with other TIMPs, and gene expression in rat tissues.Okada A., Garnier J.-M., Vicaire S., Basset P.Gene 147:301-302(1994)
Analysis of the cDNA encoding rat tissue inhibitor of metalloproteinases-1.Gibbons K.L., O'Grady R.L., Piper A.A. Rat TIMP-1 mRNA sequence.Dai W.-J., Jiang H.-C., Fu S.-B.
Tissue inhibitor of metalloproteinase-1 messenger RNA expression is enhanced relative to interstitial collagenase messenger RNA in experimental liver injury and fibrosis.Iredale J.P., Benyon R.C., Arthur M.J.P., Ferris W.F., Alcolado R., Winwood P.J., Clark N., Murphy G.Hepatology 24:176-184(1996)
Identification of a stimulator of steroid hormone synthesis isolated from testis.Boujrad N., Ogwuegbu S.O., Garnier M., Lee C.-H., Martin B.M., Papadopoulos V.Science 268:1609-1612(1995)
Purification and sequence analysis of two rat tissue inhibitors of metalloproteinases.Roswit W.T., McCourt D.W., Partridge N.C., Jeffrey J.J.Arch. Biochem. Biophys. 292:402-410(1992)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25.5 kDa
NCBI Official Full Name
metalloproteinase inhibitor 1
NCBI Official Synonym Full Names
TIMP metallopeptidase inhibitor 1
NCBI Official Symbol
Timp1
NCBI Official Synonym Symbols
Timp; TIMP-1
NCBI Protein Information
metalloproteinase inhibitor 1
UniProt Protein Name
Metalloproteinase inhibitor 1
Protein Family
UniProt Gene Name
Timp1
UniProt Synonym Gene Names
Timp-1; TIMP-1
UniProt Entry Name
TIMP1_RAT
NCBI Description
acts as an inhibitor of metalloprotease activity; may play a role in vascular tissue remodeling [RGD, Feb 2006]
Uniprot Description
Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Also stimulates steroidogenesis by Leydig and ovarian granuloma cells; procathepsin L is required for maximal activity.
Research Articles on Timp1
Similar Products
Product Notes
The Timp1 timp1 (Catalog #AAA1265605) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-217aa; Full Length. The amino acid sequence is listed below: CSCAPTHPQT AFCNSDLVIR AKFMGSPEII ETTLYQRYEI KMTKMLKGFD AVGNATGFRF AYTPAMESLC GYVHKSQNRS EEFLIAGRLR NGNLHITACS FLVPWHNLSP AQQKAFVKTY SAGCGVCTVF PCSAIPCKLE SDSHCLWTDQ ILMGSEKGYQ SDHFACLPRN PDLCTWQYLG VSMTRSLPLA KAEA. It is sometimes possible for the material contained within the vial of "Metalloproteinase inhibitor 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
