SDS-PAGE
Metalloproteinase inhibitor 1 Recombinant Protein | Timp1 recombinant protein
Recombinant Mouse Metalloproteinase inhibitor 1
Gene Names
Timp1; EPA; Clgi; Timp; TIMP-1; TPA-S1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Metalloproteinase inhibitor 1; Recombinant Mouse Metalloproteinase inhibitor 1; Collagenase inhibitor 16C8 fibroblast; Erythroid-potentiating activity; EPA; TPA-S1; TPA-induced protein; Tissue inhibitor of metalloproteinases 1; TIMP-1; Timp1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-205aa; Full Length
Sequence
CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
Sequence Length
205
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Timp1 recombinant protein
Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. 1 Publication
References
Characterization and expression of a murine gene homologous to human EPA/TIMP
a virus-induced gene in the mouse.Gewert D.R., Coulombe B., Castelino M., Skup D., Williams B.R.G.EMBO J. 6:651-657(1987)
A growth-responsive gene (16C8)
in normal mouse fibroblasts homologous to a human collagenase inhibitor with erythroid-potentiating activity
evidence for inducible and constitutive transcripts.Edwards D.R., Waterhouse P., Holman M.L., Denhardt D.T.Nucleic Acids Res. 14:8863-8878(1986)
Molecular cloning of gene sequences regulated by tumor promoters and mitogens through protein kinase C.Johnson M.D., Housey G.M., Kirschmeier P.T., Weinstein I.B.Mol. Cell. Biol. 7:2821-2829(1987)
Genes for extracellular-matrix-degrading metalloproteinases and their inhibitor, TIMP, are expressed during early mammalian development.Brenner C.A., Adler R.R., Rappolee D.A., Pedersen R.A., Werb Z.Genes Dev. 3:848-859(1989)
Molecular cloning of partial cDNA copies of two distinct mouse IFN-beta mRNAs.Skup D., Windass J.D., Sor F.S., George H., Williams B.R., Fukuhara H., de Maeyer-Guignard J., de Maeyer E.Nucleic Acids Res. 10:3069-3084(1982)
Timp1 interacts with beta-1 integrin and CD63 along melanoma genesis and confers anoikis resistance by activating PI3-K signaling pathway independently of Akt phosphorylation.Toricelli M., Melo F.H., Peres G.B., Silva D.C., Jasiulionis M.G.Mol. Cancer 12:22-22(2013)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36.2 kDa
NCBI Official Full Name
metalloproteinase inhibitor 1 isoform a
NCBI Official Synonym Full Names
tissue inhibitor of metalloproteinase 1
NCBI Official Symbol
Timp1
NCBI Official Synonym Symbols
EPA; Clgi; Timp; TIMP-1; TPA-S1
NCBI Protein Information
metalloproteinase inhibitor 1
UniProt Protein Name
Metalloproteinase inhibitor 1
Protein Family
UniProt Gene Name
Timp1
UniProt Synonym Gene Names
Timp; Timp-1; EPA; TIMP-1
UniProt Entry Name
TIMP1_MOUSE
Uniprot Description
TIMP1: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Also mediates erythropoiesis in vitro; but, unlike IL-3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-11, MMP-12, MMP-13 and MMP-16. Does not act on MMP-14. Belongs to the protease inhibitor I35 (TIMP) family.
Protein type: Secreted; Motility/polarity/chemotaxis; Secreted, signal peptide
Cellular Component: basement membrane; extracellular matrix; extracellular region; extracellular space; proteinaceous extracellular matrix
Molecular Function: cytokine activity; enzyme inhibitor activity; growth factor activity; metal ion binding; metalloendopeptidase inhibitor activity; protease binding; protease inhibitor activity
Biological Process: cell activation; negative regulation of apoptosis; negative regulation of membrane protein ectodomain proteolysis; negative regulation of metalloenzyme activity; negative regulation of peptidase activity; positive regulation of cell proliferation; response to cytokine stimulus; response to hormone stimulus
Research Articles on Timp1
Similar Products
Product Notes
The Timp1 timp1 (Catalog #AAA959921) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-205aa; Full Length. The amino acid sequence is listed below: CSCAPPHPQT AFCNSDLVIR AKFMGSPEIN ETTLYQRYKI KMTKMLKGFK AVGNAADIRY AYTPVMESLC GYAHKSQNRS EEFLITGRLR NGNLHISACS FLVPWRTLSP AQQRAFSKTY SAGCGVCTVF PCLSIPCKLE SDTHCLWTDQ VLVGSEDYQS RHFACLPRNP GLCTWRSLGA R. It is sometimes possible for the material contained within the vial of "Metalloproteinase inhibitor 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
