SDS-PAGE
Transforming growth factor beta-1 Recombinant Protein | tgfb1 recombinant protein
Recombinant Xenopus laevis (African clawed frog) Transforming growth factor beta-1
Gene Names
tgfb1; ced; lap; dpd1; tgfb; tgfb5; tgfbeta; tgf-beta; TGF-beta5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transforming growth factor beta-1; Recombinant Xenopus laevis (African clawed frog) Transforming growth factor beta-1; TGF-beta-1; TGF-beta-5; tgfb1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
271-382aa; Full Length
Sequence
GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS
Sequence Length
382
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for tgfb1 recombinant protein
Important role in certain aspects of differentiation.
Product Categories/Family for tgfb1 recombinant protein
References
"Identification of a novel transforming growth factor-beta (TGF-beta 5) mRNA in Xenopus laevis."
Kondaiah P., Sands M.J., Smith J.M., Fields A., Roberts A.B., Sporn M.B., Melton D.A.
J. Biol. Chem. 265:1089-1093(1990)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14.6 kDa
NCBI Official Full Name
transforming growth factor beta-1
NCBI Official Synonym Full Names
transforming growth factor beta 1
NCBI Official Symbol
tgfb1
NCBI Official Synonym Symbols
ced; lap; dpd1; tgfb; tgfb5; tgfbeta; tgf-beta; TGF-beta5
NCBI Protein Information
transforming growth factor beta-1
UniProt Protein Name
Transforming growth factor beta-1
Protein Family
UniProt Gene Name
tgfb1
UniProt Synonym Gene Names
TGF-beta-1
UniProt Entry Name
TGFB1_XENLA
Uniprot Description
Important role in certain aspects of differentiation.
Research Articles on tgfb1
Similar Products
Product Notes
The tgfb1 tgfb1 (Catalog #AAA1187612) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 271-382aa; Full Length. The amino acid sequence is listed below: GVGQEYCFGN NGPNCCVKPL YINFRKDLGW KWIHEPKGYE ANYCLGNCPY IWSMDTQYSK VLSLYNQNNP GASISPCCVP DVLEPLPIIY YVGRTAKVEQ LSNMVVRSCN CS. It is sometimes possible for the material contained within the vial of "Transforming growth factor beta-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
