Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Sec-independent protein translocase protein TatCy (tatC2) Recombinant Protein | tatCY recombinant protein

Recombinant Bacillus subtilis Sec-independent protein translocase protein TatCy (tatC2)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sec-independent protein translocase protein TatCy (tatC2); Recombinant Bacillus subtilis Sec-independent protein translocase protein TatCy (tatC2); Recombinant Sec-independent protein translocase protein TatCy (tatC2); Sec-independent protein translocase protein TatCy; tatCY recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-254
Sequence
MTRMKVNQMSLLEHIAELRKRLLIVALAFVVFFIAGFFLAKPIIVYLQETDEAKQLTLNAFNLTDPLYVFMQFAFIIGIVLTSPVILYQLWAFVSPGLYEKERKVTLSYIPVSILLFLAGLSFSYYILFPFVVDFMKRISQDLNVNQVIGINEYFHFLLQLTIPFGLLFQMPVILMFLTRLGIVTPMFLAKIRKYAYFTLLVIAALITPPELLSHMMVTVPLLILYEISILISKAAYRKAQKSSAADRDVSSGQ
Sequence Length
254
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,056 Da
NCBI Official Full Name
twin-arginine pre-protein translocation pathway protein
NCBI Official Symbol
tatCY
NCBI Protein Information
twin-arginine pre-protein translocation pathway protein
UniProt Protein Name
Sec-independent protein translocase protein TatCy
UniProt Gene Name
tatC2
UniProt Synonym Gene Names
tatCy; ydiJ
UniProt Entry Name
TATCY_BACSU

Uniprot Description

Function: Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. Required for YwbN secretion. Ref.5

Subunit structure: Forms a complex with TatAy. Two types of complexes exist: one composed of TatAy and TatCy, and another composed only of TatAy.

Subcellular location: Cell membrane; Multi-pass membrane protein Ref.5.

Miscellaneous: B.subtilis possesses two minimal, substrate-specific, Tat translocases: TatAd-TatCd and TatAy-TatCy, each one composed of a TatA and a TatC protein. TatA is bifunctional and performs the function of both the TatA and TatB proteins of Gram-negative organisms. HAMAP-Rule MF_00902

Sequence similarities: Belongs to the TatC family.

Research Articles on tatCY

Similar Products

Product Notes

The tatCY tatc2 (Catalog #AAA1244822) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-254. The amino acid sequence is listed below: MTRMKVNQMS LLEHIAELRK RLLIVALAFV VFFIAGFFLA KPIIVYLQET DEAKQLTLNA FNLTDPLYVF MQFAFIIGIV LTSPVILYQL WAFVSPGLYE KERKVTLSYI PVSILLFLAG LSFSYYILFP FVVDFMKRIS QDLNVNQVIG INEYFHFLLQ LTIPFGLLFQ MPVILMFLTR LGIVTPMFLA KIRKYAYFTL LVIAALITPP ELLSHMMVTV PLLILYEISI LISKAAYRKA QKSSAADRDV SSGQ. It is sometimes possible for the material contained within the vial of "Sec-independent protein translocase protein TatCy (tatC2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.