Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CXXC4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Rabbit CXXC4 Polyclonal Antibody | anti-CXXC4 antibody

CXXC4 Antibody - C-terminal region

Gene Names
CXXC4; IDAX
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CXXC4; Polyclonal Antibody; CXXC4 Antibody - C-terminal region; anti-CXXC4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCE
Sequence Length
198
Applicable Applications for anti-CXXC4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CXXC4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CXXC4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Western Blot (WB) (WB Suggested Anti-CXXC4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)
Related Product Information for anti-CXXC4 antibody
This is a rabbit polyclonal antibody against CXXC4. It was validated on Western Blot

Target Description: CXXC4 acts as a negative regulator of the Wnt signaling pathway via its interaction with DVL1.
Product Categories/Family for anti-CXXC4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
CXXC-type zinc finger protein 4
NCBI Official Synonym Full Names
CXXC finger protein 4
NCBI Official Symbol
CXXC4
NCBI Official Synonym Symbols
IDAX
NCBI Protein Information
CXXC-type zinc finger protein 4
UniProt Protein Name
CXXC-type zinc finger protein 4
UniProt Gene Name
CXXC4
UniProt Synonym Gene Names
IDAX
UniProt Entry Name
CXXC4_HUMAN

NCBI Description

This gene encodes a CXXC-type zinc finger domain-containing protein that functions as an antagonist of the canonical wingless/integrated signaling pathway. The encoded protein negatively regulates wingless/integrated signaling through interaction with the post synaptic density protein/ Drosophila disc large tumor suppressor/ zonula occludens-1 protein domain of Dishevelled, a scaffolding protein required for the stabilization of the transcriptional co-activator beta-catenin. In addition, the CXXC domain of this protein has been shown to bind unmethylated CpG dinucleotides, localize to promoters and CpG islands, and interact with the catalytic domain of methylcytosine dioxygenase ten-eleven-translocation 2, an iron and alpha-ketoglutarate-dependent dioxygenase that modifies the methylation status of DNA. In humans, a mutation in this gene has been associated with development of malignant renal cell carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]

Uniprot Description

CXXC4: Acts as a negative regulator of the Wnt signaling pathway via its interaction with DVL1.

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 4q24

Cellular Component: cytoplasmic membrane-bound vesicle; cytoplasm; cytoplasmic vesicle

Molecular Function: DNA binding; zinc ion binding; PDZ domain binding

Biological Process: zygotic determination of dorsal/ventral axis; negative regulation of Wnt receptor signaling pathway; Wnt receptor signaling pathway

Research Articles on CXXC4

Similar Products

Product Notes

The CXXC4 cxxc4 (Catalog #AAA3216816) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CXXC4 Antibody - C-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CXXC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CXXC4 cxxc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGAGGANPAK KKRKRCGVCV PCKRLINCGV CSSCRNRKTG HQICKFRKCE. It is sometimes possible for the material contained within the vial of "CXXC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.