Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human SULT1A1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 32 kDa.)

SULT1A1 recombinant protein

Recombinant Human SULT1A1 Protein

Gene Names
SULT1A1; PST; STP; STP1; P-PST; ST1A1; ST1A3; TSPST1; HAST1/HAST2
Purity
>95% by SDS-PAGE.
Synonyms
SULT1A1; Recombinant Human SULT1A1 Protein; HAST1/HAST2; P-PST; PST; ST1A1; ST1A3; STP; STP1; TSPST1; SULT1A1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.
Sequence
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Sequence Length
295
Species
Human
Endotoxin
< 0.01 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human SULT1A1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 32 kDa.)

SDS-Page (Recombinant Human SULT1A1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 32 kDa.)
Related Product Information for SULT1A1 recombinant protein
Description: Recombinant Human SULT1A1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Leu295) of human SULT1A1 (Accession #NP_001046.2) fused with a 6xHis tag at the C-terminus.

Background: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds.Particularly SULT1A1 (Sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1), a member of the sulfotransferase 1 subfamily, which is a major pathway for drug metabolism in humans. Statistically significant associations were observed between the SULT1A1 genotype (Arg213His) and age, obesity and certain neoplasias (mammary, pulmonary, esophageal and urothelial cancer). Furthermore, the polymorphism of the SULT1A1 may be closely associated with breast cancer.
Product Categories/Family for SULT1A1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Sulfotransferase 1A1
NCBI Official Synonym Full Names
sulfotransferase family 1A member 1
NCBI Official Symbol
SULT1A1
NCBI Official Synonym Symbols
PST; STP; STP1; P-PST; ST1A1; ST1A3; TSPST1; HAST1/HAST2
NCBI Protein Information
sulfotransferase 1A1
UniProt Protein Name
Sulfotransferase 1A1
Protein Family
UniProt Gene Name
SULT1A1
UniProt Synonym Gene Names
STP; STP1; ST1A1; P-PST 1; Ts-PST
UniProt Entry Name
ST1A1_HUMAN

NCBI Description

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SULT1A1: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N- hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk. Belongs to the sulfotransferase 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.8.2.1; Energy Metabolism - sulfur; Transferase

Chromosomal Location of Human Ortholog: 16p12.1

Cellular Component: cytosol

Molecular Function: sulfotransferase activity; steroid sulfotransferase activity; flavonol 3-sulfotransferase activity; aryl sulfotransferase activity

Biological Process: estrogen metabolic process; flavonoid metabolic process; xenobiotic metabolic process; sulfation; catecholamine metabolic process; amine metabolic process; 3'-phosphoadenosine 5'-phosphosulfate metabolic process

Research Articles on SULT1A1

Similar Products

Product Notes

The SULT1A1 sult1a1 (Catalog #AAA9139640) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MELIQDTSRP PLEYVKGVPL IKYFAEALGP LQSFQARPDD LLISTYPKSG TTWVSQILDM IYQGGDLEKC HRAPIFMRVP FLEFKAPGIP SGMETLKDTP APRLLKTHLP LALLPQTLLD QKVKVVYVAR NAKDVAVSYY HFYHMAKVHP EPGTWDSFLE KFMVGEVSYG SWYQHVQEWW ELSRTHPVLY LFYEDMKENP KREIQKILEF VGRSLPEETV DFVVQHTSFK EMKKNPMTNY TTVPQEFMDH SISPFMRKGM AGDWKTTFTV AQNERFDADY AEKMAGCSLS FRSEL. It is sometimes possible for the material contained within the vial of "SULT1A1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.