Mouse anti-Human NCOA5 Monoclonal Antibody | anti-NCOA5 antibody

NCOA5 (Nuclear Receptor Coactivator 5, NCoA-5, Coactivator Independent of AF-2, CIA, KIAA1637, bA465L10.6) (FITC)

Cat. Num. AAA6148411

• Gene Names: NCOA5; CIA; bA465L10.6
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NCOA5; Monoclonal Antibody; NCOA5 (Nuclear Receptor Coactivator 5; NCoA-5; Coactivator Independent of AF-2; CIA; KIAA1637; bA465L10.6) (FITC); anti-NCOA5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1E9
• Specificity: Recognizes human NCOA5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-NCOA5 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-316 from human NCOA5 (AAH56872) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAGMPGTAETFETPETCGTTDMRDSRDPMYRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPGELRGRAEARFPANHSGRPRVPR
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (60.76kD).)

Testing Data

(Detection limit for recombinant GST tagged NCOA5 is ~3ng/ml as a capture antibody.)

Related Product Information for anti-NCOA5 antibody

Nuclear receptor coregulator that can have both coactivator and corepressor functions. Interacts with nuclear receptors for steroids (ESR1 and ESR2) independently of the steroid binding domain (AF-2) of the ESR receptors, and with the orphan nuclear receptor NR1D2. Involved in the coactivation of nuclear steroid receptors (ER) as well as the corepression of MYC in response to 17-beta-estradiol (E2).

Product Categories/Family for anti-NCOA5 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 34785145
• NCBI GeneID: 57727
• Molecular Weight: 65,536 Da
• NCBI Official Full Name: Homo sapiens cDNA clone IMAGE:5730450, containing frame-shift errors
• NCBI Official Synonym Full Names: nuclear receptor coactivator 5
• NCBI Official Symbol: NCOA5
• NCBI Official Synonym Symbols: CIA; bA465L10.6
• NCBI Protein Information: nuclear receptor coactivator 5
• Protein Family: Nuclear receptor coactivator

NCBI Description

This gene encodes a coregulator for the alpha and beta estrogen receptors and the orphan nuclear receptor NR1D2. The protein localizes to the nucleus, and is thought to have both coactivator and corepressor functions. Its interaction with nuclear receptors is independent of the AF2 domain on the receptors, which is known to regulate interaction with other coreceptors. Two alternatively spliced transcript variants for this gene have been described. However, the full length nature of one of the variants has not been determined. [provided by RefSeq, Jul 2008]