Sex-determining region Y protein (SRY) Recombinant Protein | SRY recombinant protein
Recombinant Dog Sex-determining region Y protein (SRY)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sex-determining region Y protein (SRY); Recombinant Dog Sex-determining region Y protein (SRY); SRY recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-220, Full length protein
Sequence
MFRALNCDDHGAAVQQNAFGFPRKSSDRWTDNSTSNYRCESGGNGRDSGRNRVRRPMNAFLVWSRDQRRKMALENPQMQNSEISKQLGYQWKMLTEAEKWPFFEEAQRLQAMHREKYPDYKYRPRRKATAQKSHKLLPAASSSMLCKQVHVDERFYPFTYTDSCSRAAHTRMEDQLSCSQPMSTARSLLQQEYHSSSASLRDSPETLAAQMSADASFYSK
Sequence Length
220
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SRY recombinant protein
This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
25,505 Da
NCBI Official Full Name
Sex-determining region Y protein
UniProt Protein Name
Sex-determining region Y protein
Protein Family
UniProt Gene Name
SRY
UniProt Synonym Gene Names
TDF
Uniprot Description
Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. In male adult brain involved in the maintenance of motor functions of dopaminergic neurons. Involved in different aspects of gene regulation including promoter activation or repression. Promotes DNA bending. SRY HMG box recognizes DNA by partial intercalation in the minor groove. Also involved in pre-mRNA splicing. Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3' ().
Similar Products
Product Notes
The SRY sry (Catalog #AAA1473363) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-220, Full length protein. The amino acid sequence is listed below: MFRALNCDDH GAAVQQNAFG FPRKSSDRWT DNSTSNYRCE SGGNGRDSGR NRVRRPMNAF LVWSRDQRRK MALENPQMQN SEISKQLGYQ WKMLTEAEKW PFFEEAQRLQ AMHREKYPDY KYRPRRKATA QKSHKLLPAA SSSMLCKQVH VDERFYPFTY TDSCSRAAHT RMEDQLSCSQ PMSTARSLLQ QEYHSSSASL RDSPETLAAQ MSADASFYSK. It is sometimes possible for the material contained within the vial of "Sex-determining region Y protein (SRY), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
