Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SRYSample Type: 721_BAntibody Dilution: 1.0ug/mlSRY is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit anti-Human, Rat SRY Polyclonal Antibody | anti-SRY antibody

SRY antibody - middle region

Gene Names
SRY; TDF; TDY; SRXX1; SRXY1
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SRY; Polyclonal Antibody; SRY antibody - middle region; anti-SRY antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL
Sequence Length
204
Applicable Applications for anti-SRY antibody
Western Blot (WB)
Homology
Human: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SRY
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SRYSample Type: 721_BAntibody Dilution: 1.0ug/mlSRY is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: SRYSample Type: 721_BAntibody Dilution: 1.0ug/mlSRY is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB)

(Host: RabbitTarget Name: SRYSample Type: HepG2Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SRYSample Type: HepG2Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-SRY Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-SRY Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-SRY antibody
This is a rabbit polyclonal antibody against SRY. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SRY is an intronless gene that encodes for a transcription factor, which is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor(TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome.This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
sex-determining region Y protein
NCBI Official Synonym Full Names
sex determining region Y
NCBI Official Symbol
SRY
NCBI Official Synonym Symbols
TDF; TDY; SRXX1; SRXY1
NCBI Protein Information
sex-determining region Y protein
UniProt Protein Name
Sex-determining region Y protein
Protein Family
UniProt Gene Name
SRY
UniProt Synonym Gene Names
TDF
UniProt Entry Name
SRY_HUMAN

NCBI Description

This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. This protein is the testis-determining factor (TDF), which initiates male sex determination. Mutations in this gene give rise to XY females with gonadal dysgenesis (Swyer syndrome); translocation of part of the Y chromosome containing this gene to the X chromosome causes XX male syndrome. [provided by RefSeq, Jul 2008]

Uniprot Description

SRY: Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. In male adult brain involved in the maintenance of motor functions of dopaminergic neurons. Involved in different aspects of gene regulation including promoter activation or repression. Promotes DNA bending. SRY HMG box recognizes DNA by partial intercalation in the minor groove. Also involved in pre-mRNA splicing. Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'. Defects in SRY are the cause of 46,XY sex reversal type 1 (SRXY1). A condition characterized by male-to-female sex reversal in the presence of a normal 46,XY karyotype. Patients manifest rapid and early degeneration of their gonads, which are present in the adult as 'streak gonads', consisting mainly of fibrous tissue and variable amounts of ovarian stroma. As a result these patients do not develop secondary sexual characteristics at puberty. The external genitalia in these subjects are completely female, and Muellerian structures are normal. A 45,X chromosomal aberration involving SRY is found in Turner syndrome, a disease characterized by gonadal dysgenesis with short stature, streak gonads, variable abnormalities such as webbing of the neck, cubitus valgus, cardiac defects, low posterior hair line. The phenotype is female. Defects in SRY are the cause of 46,XX sex reversal type 1 (SRXX1). A condition in which male gonads develop in a genetic female (female to male sex reversal). Belongs to the SRY family.

Protein type: DNA-binding; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: Yp11.3

Cellular Component: cytoplasm; nuclear speck; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; calmodulin binding; DNA binding; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; male sex determination; cell differentiation; sex differentiation

Disease: 46,xx Sex Reversal 1; 46,xy Sex Reversal 1

Research Articles on SRY

Similar Products

Product Notes

The SRY sry (Catalog #AAA3202296) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SRY antibody - middle region reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SRY can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SRY sry for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SEVQLDNRLY RDDCTKATHS RMEHQLGHLP PINAASSPQQ RDRYSHWTKL. It is sometimes possible for the material contained within the vial of "SRY, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.